Recently Added Phages

Casey Pajaza Pikmin Adler Kida

Recently Modified Phages

Asriel Zeesoli Thonko Kimona TreyKay

Recently Finished Phages

BayC (BG) Azathoth (AN) Copper (AN) Sibs6 (A1) Roots515 (C1)
Gene Details
BLAST the gene product on PhagesDB
BLAST the gene product on NCBI
Details for gene Ollie_Draft_62
Phage Ollie · Cluster A · 50721 bp
Gene Ollie_Draft_62
Pham (click for Pham view →)
Genome Position 38024 to 37860 (Reverse)
Length 165 base pairs
54 amino acids
Codons Start: GTG
Stop: TGA
Amino Acid Sequence

Click to View

MNEDNVLRVGLNFPNGDLVEVAVTGWTDPLNALSALRHLGTEEALSKIYEAGTE
Notes
Members (62) of Pham 1661