Recently Added Phages

Casey Pajaza Pikmin Adler Kida

Recently Modified Phages

Asriel Zeesoli Thonko Kimona TreyKay

Recently Finished Phages

BayC (BG) Azathoth (AN) Copper (AN) Sibs6 (A1) Roots515 (C1)
Gene Details
BLAST the gene product on PhagesDB
BLAST the gene product on NCBI
Details for gene Ollie_Draft_93
Phage Ollie · Cluster A · 50721 bp
Gene Ollie_Draft_93
Pham (click for Pham view →)
Genome Position 49321 to 49205 (Reverse)
Length 117 base pairs
38 amino acids
Codons Start: ATG
Stop: TAA
Amino Acid Sequence

Click to View

MIYGDHKVISVNARGDVLRVLVEDMETGDREYRVIPMA
Notes
Members (157) of Pham 387