Seq-submit ::= { sub { contact { contact { name name { last "Page" , first "Shallee" , initials "T" } , affil std { affil "U. Maine at Machias" , div "Env & Biol Sci" , city "Machias" , sub "Maine" , country "USA" , street "116 O'Brien Ave" , email "shallee.page@gmail.com" , fax "" , phone "" , postal-code "04655" } } } , cit { authors { names std { { name name { last "Adair" , first "Tamarah" , initials "L" } } , { name name { last "Athey" , first "Robert" , initials "M" } } , { name name { last "Brashears" , first "Caitlyn" , initials "." } } , { name name { last "Chitturi" , first "Aasmitha" , initials "." } } , { name name { last "Curtis" , first "Kyra" , initials "N" } } , { name name { last "Fitzgerald" , first "Margaret" , initials "D" } } , { name name { last "Hamza" , first "Dalia" , initials "A" } } , { name name { last "Holden" , first "Alexandria" , initials "R" } } , { name name { last "Kallemeyn" , first "Mackenzie" , initials "A" } } , { name name { last "Kim" , first "Skye" , initials "J" } } , { name name { last "Konde" , first "Sai Aparna" , initials "." } } , { name name { last "Kwok" , first "Vivian" , initials "E" } } , { name name { last "Long" , first "Kayla" , initials "D" } } , { name name { last "Lucas" , first "Lathan" , initials "G" } } , { name name { last "Merritt" , first "Tessa" , initials "J" } } , { name name { last "Nesbit" , first "Taylor" , initials "A" } } , { name name { last "Nguyen" , first "Courtney" , initials "N" } } , { name name { last "Ornelas-Lopez" , first "Eli" , initials "X" } } , { name name { last "Patel" , first "Anjali" , initials "." } } , { name name { last "Philip" , first "Timothy" , initials "P" } } , { name name { last "Ragsdale" , first "Caroline" , initials "H" } } , { name name { last "Sheikh" , first "Aadil" , initials "." } } , { name name { last "Smith" , first "Courtney" , initials "L" } } , { name name { last "Stokdyk" , first "Kasey" , initials "A" } } , { name name { last "Towsley" , first "Toby" , initials "N" } } , { name name { last "Walrod" , first "Jeffrey" , initials "D" } } , { name name { last "Wilson" , first "Jennifer" , initials "A" } } , { name name { last "Wingerson" , first "Erin" , initials "N" } } , { name name { last "Page" , first "S" , initials "T" } } , { name name { last "Bradley" , first "K" , initials "W" } } , { name name { last "Asai" , first "D" , initials "J" } } , { name name { last "Bowman" , first "C" , initials "A" } } , { name name { last "Russell" , first "D" , initials "A" } } , { name name { last "Pope" , first "W" , initials "H" } } , { name name { last "Jacobs-Sera" , first "D" , initials "." } } , { name name { last "Hendrix" , first "R" , initials "W" } } , { name name { last "Hatfull" , first "G" , initials "F" } } } , affil std { affil "U. Maine at Machias" , div "Env & Biol Sci" , city "Machias" , sub "Maine" , country "USA" , street "116 O'Brien Ave" , postal-code "04655" } } , date std { year 2016 , month 6 , day 23 } } , subtype new , tool "tbl2asn 17.1 - MS WINDOWS VISTA" } , data entrys { set { class nuc-prot , descr { source { org { taxname "Arthrobacter phage" , orgname { lineage "Viruses; dsDNA viruses, no RNA stage; Caudovirales; Siphoviridae" , gcode 11 } } , subtype { { subtype lab-host , name "Arthrobacter sp. ATCC 21022" } , { subtype country , name "USA" } , { subtype isolation-source , name "Soil, Katy, TX" } , { subtype lat-lon , name "29.796007 N 95.720535 W" } , { subtype collection-date , name "10-Sep-2014" } , { subtype collected-by , name "Courtney Nguyen" } , { subtype identified-by , name "Courtney Nguyen" } , { subtype other , name "complete genome" } } } , create-date std { year 2016 , month 6 , day 23 } } , seq-set { seq { id { local str "Courtney3" } , descr { molinfo { biomol genomic } , comment "Phage isolation, DNA preparation and annotation analysis were performed at~Baylor University, Katy, TX, USA~Illumina Sequencing to 10703x coverage was performed at~Pittsburgh Bacteriophage Institute, U. Pittsburgh, Pittsburgh, PA, USA~Assembly performed with Newbler and Consed as of Feb 2011~Supported by the Science Education Alliance, Howard Hughes Medical Institute, Chevy Chase MD" } , inst { repr raw , mol dna , length 15556 , seq-data ncbi2na '58DFFF550740100A29580B8583195639E56AFE09D4085A4E24276 049BE754917EE39D4227AB7FE0214A342D3A649DB4E8DF95396D99D2E4965A42925A4495C96D09 674E8247E109D54052C1608E6FE590E3808A5A5CB38914156481D1BD8CE07D467F6DFA7B56F9A1 448A5A4E39FA925AE324381429A629527ED3A671B98C96384F8A56AA1E1B2EA82E857F899CE866 905BA5B9F90BCE9D1DB9E9069E5BAD7B6B9D6E92B87F2A1459BA1AFA54E48E38B395B2BEB1361B 018B4969362C56B81A618849106C28EB43EEB2C99F9E189E56279E9A7FA24351A46B3945096115 AA458189FA9235FA4594279FA5A49D396E92360BA466E93488066F8E351A6F16F158FBAE746B95 690D6908619D39B12C7E741B9FE0B96C16C29BDC469501A90A19C699AE9E8DFB4284F8A1A55FB5 4BDB490993E796925099E1BD586A4914F256F6558494227E469CC559386E3BE86233F953864965 A4185D3A99CD69695274671584241CE9FB491A5A469E12EBFDE036EAF850A5A725B40849AE5A4F 971FE2E8B7E786A7A15B3855401E9EF515A4BEB444347FA28DF9618668494094AA8BAF99933381 6FA1891898A4B4F86E980EA11BE9699BEB95BD4EA442E1AE9718AE99184A2F99A63739B9E808D5 884A425A670276E490A49AE58BA7E55A5B6508DC6E8816950A632A961869A1414292E16107E65A 7950E56C9AA9069B62B8415E1256A1FE7167E6F9713AA46F861A4431D461A615AA45B925BE2926 9056953AB8490AFFC965B44B22950F5227AE9A416C99C69C4E24265A51A45905A43713A862A072 6E35A7E108743D24FBEE7F917EE571BA6247510610A77267A496961A4417869918A98A1045FB49 A5652425C4A9190269E5AA4C3549AEC3FE016F1AA93128FB7B39573A0C151C9425A5A4F7E56D29 E5949B23BDC96906DBB4EA0CE58178569D466347D4077457A747E7E9B62CED04D8591A494EA4FA E5BA40BE6801A4E69FCDA5B39574F9F16E9461B9F95B41508DBFE4958A5A5A55AFED18E9FAB848 2674EF71A429FAFC5BE0819CE58A1A5A5A467E6FABD58BA0258BD04596949DB80971A6E84C8559 E1B8D66E8693E18AB7BE07199256D71B8256A43613E59696E4D23056B5624F87E452169A6159E1 4189232199D3226FA93605A625001A69B89F4505026F8A40053AA495BA241E7CD869641BA497E0 4F95A925A7F5A6EA4BE3949B01A49D4F17124125725919B89E3E1C667F45B37A09CF9676FD24E8 E13DE5A5A44EB92BD873D627BE66987D9E56CE8E7C40B650239203F1D048A271994E89FA5A53E8 ADDA0E091933F837B596AF9E1A4266D06645349A623ED831AACBA844525FA5618DFE696924D127 5465BED42B4239FB924E116264BBA9FDE876FA2841A45096FE59BD0AE5E1AE58A986191C142925 0691DB8F7F49BE9B93BD283127F8618A907E76E4E6D0678082FD5CB4535693F80199DB9386C964 04A02292C385B6080E6E54A776506448556905696C95F9E59E79600E55B65A78AF155265496986 91415A46516F9629D29E55CF4ADAE96D9A4E8DFD259E504DB4F891F99069F9690649D2E591ED61 BAE5A58E39688ABFDD6971BD36B89EE929BD06385A59F3619BDA455A909E169142B73A7A0BA8DF 9416D50ADA59C65A4108581F5350567421ED5A78358E74A1F67969EA1BA4642C4D85FA66DA1F4F 8B5BBD6EB9459A3C5BF921E037AF6B89235F9A290582F969B851AEFAB99EDD2F41B629E56CDAE5 6DFD86352FE9B2193A8A0FCF05D520992B96EBA780912A49B627A1A4E029665A6BB37F499817AB 7EB96948D7E99A1098964171C6296926C5CD66C1A64A13566E9A6F85FA6DFE9C65A6736E4E155A 90DEACDE186876EC1538DB06B204AF286E9CA9E5A4DA15A57208E51A5905067F6F8997EAF96392 54236F8693E5B9E8618699103BD896967846B9FAE508E7A691A77165A641256268B6098D161969 1B7FEF95ACE12613096F1F827E1A7F9A5588369C264E6873A80F570084F9633AD1A6969B969E5B E155A87E05C56A93AB8556A7ED27F86E7A1BA1124FCE1BF84FC5CBE55E146B96D4F67412DFAA13 BE98235A5A5712BEB825395B4EB81757051AE5866F9699C7CD24D86441C1A2870510E9C786C3C4 B6956967D14DAF48C489E16DFF5AD2B8527E69DB9626E86FA61D4DC6EFA1A6982ED6985B162DBA 16ED6918EF9287FA66145242160E9EF6245AA608CE5BF97195604B94AA4288F169B9E16F825360 3E9A61B02142504DE1FE2F427EFA175643E912FD65A70EA4601DC65BAFA6998274A246788025A6 48CE0207F796D05986C94136FF95B65224124505109A827AB2C4B5B9699C5482D2434D6EEA4990 0915C6952EB93C7A442A41C465435FABB47E591008581613A7E56B3465A4C89834F050B04A26C0 20D3A649CD25580B4FB4E7A0D35A458627868B116F4858C16E198F4BA86E15A55B676E969BD060 91539FC4E13D7E4E9198E45A16990409DD9F862F4E02196F8AD0AC7B49A5A4290D85616296F962 86D7EE8571525AC967365E32D89C99F90504F91626CEA7962D4582C3241247453FE820602CA590 ED5B125BFE96F6CDB468840229410A93E1847BC909E842FE26697210A693E5A69E59691E5B9F9B D942005A613A624F9524019699EF849BBD0A9065085B418BD9661A796109EA1ED69267C5240E93 6B8DAF449D0013A9B953A34AF96AD4506174F942AE587E9E53BDA69185D6396C86673527E758A6 26E154D882C69B4934386690D4250009227EA7E5ABED6B82584206411E16614E91EF9209012586 61AA4BF99A827849925AE54A062706608D4219699827E926CF5E5A53A4964946925A693A713A93 4801244B9E7AE7E5A8D3E9A6E96998D79F341AA474093A6259C69E5B6796E42EB1D065B0ED2505 43E97EEB9F94F96476E9697EEEA7C4106EAFAF4087FBE1427FE59CDAE5BAE9E5B6643AF50866E8 1067B46F6C4A6C4D827EB534D3419EFFC5A8C48696DAE5BA543DF45864E81067B46F6C4A6C4CD6 6EA93CD34396FF45AAC4B596DAE5BA787FF59066EA6BE5BA432D969B0D676E90969B0196EF4196 EA74FCCD69B6D043B5906EFF5D2EF41B8F72A36C169B4F969B98A64321AAC14916E489B6524D34 1AA476E966F41FED94B9696C19FF969345AA4350A6D3E9E8D4019BE27ABDA0DF909A4DA419EDA5 23BEA5FA6A9869661A68655E8749C7FA69A6156AFE2A6994424DFE9A811FDFEB9569150A49A558 D36D05E16C06A90E8561A5B2909237184F79E0B1F996C1AE1BAE0E89C553AE10D422924785B41A 681F1056A425A59BD35E58497F269F86B89C69A61DB9921455A56A49349A59BBD3548124F59BF4 5664C9E15AE4FE6E514D06986339A3BFC6916E8623EF36286E8698967969CD35504969A39025C8 69E8CB8612A905C629F4796196907CDE7A1A6466ED25FA85054299849C109CEBF1C65A4996B8B8 B5695CEDB8594E9209D6269F9699D0243BAF41065A6970F08D8237F367AC459692FD06987FD167 8A1D2A87CD55AFAE59B6B0A34DBA2E607319416A227A4109FB96C86936E75389E573A06BA27954 9D0268426D45696FAB86F429B684F7A616795B7CDBAA1C753A5B4405B62A4A1A691D0E67EE5A5A E7B46F418A9A466E15BD69E7A855A84F84248139F80DF5066E7E4D36A21FA5BA6DB707F95BC6EB A59F67956F159034D8993C1A0E9863ED0E15BEBD6B9E5A5A4B36E9695CE48584C1853A40D2359B 62CDABAD1E114E8901688E394996DC6D0458B4FA6971AE53AA60934B1217E516E9692599628429 1969F9622529905BDC5A7E5842B9A7EED7448D5A099606E91A7F126584FABDA927EDCEE5619969 6E7E9073458B4AA2415E1BEA9889696F89E86F8965A3CF69158A6746FE9824641144556F4137E0 9ED62F4004D14CA92740C6D264FA2830893A3734AA4F5601E1619A326DC6674283126064EFC589 E84239466A3EE91BD43743A741A5A4DAE596D3AE8DFBA5B9676E96967AC42BE2CEDFC526E969AD 50E194F97387D002DA4B818741260691B4F83869D5267FB71169567969074087884B591CEE8094 524180640134290D7E56A412926E9FD16504B6E97F1B3D8CEA8712453843857A7CD57E78A98843 508BDAE56D8DBDC5A0BCA127EA4C1A4D85FAB95ADA4556DCE53A49691AE75196BEB5463454E9E1 53465A4F9EE7854D1A6244D26972645CD42BAEBB456981BB62BEA49D3E9C74AA116A165A6F593B 53E6279E9244968FAD41A719696CD67F8BD1C0A22736E131433785A121095BD4B655A19254F4B6 3473D3EBA8425606C15B6FD2A45B63E9FE5ABE91469493D3C6E96296966E9B97EDD178413E4E91 969869A41A56A410452CFA4F8B90566D2D61A61C651AE962FAD6E179896DC690FE58DCD745A47A 1091A2E57A05CE17E560D0587259065A45344A285038156040164E76F98DC4191DF4108224E586 5A30D2D4DB69AE091F862F8C0410E1B4235F94276088D05809DC285384942505540B2696DAED26 99DE12DF8DBFAB26A1CE693E3396920B66967374B2FB86F6B969C4D0898AE1206E3A0262B891BE 56326913A190562BEE676F1064F89909C8419E5109A71B6298D024852F990A31624210A43E2DAC 8120710407BE70EBADA4694CA499A425E7EF17E9B495C5C0CA520E55B045C10ABE6A93FE7B41B2 2F8493A42409C2EE018583396939C69938D665CE9699B6B8E786C8A1FA5B8E7A0B926227E19A73 50DA5BA12526E2053A4A2FA9A13E56A61691496509E5482031A6CC103FE8CF87CCAF7CCD6661BE A5A1E5A5A45BD560C9D141264542465A616D109D629814EA6795392FE69E1EE9FBB4958B666908 D53E2D3952658C9699DCE67F5CEDA4D2E7E5A599FA1DBBED3A642BCE50B0E13C3471FBF1B4362C 74FCDA55671FAFA6EDB07EDBF4E522AB326F4A9384890D018061207ED8278589A589E7A8B49098 1BE84ACD0965A5C78550D6953D2A02A643196BF8674A1B9269F9EC9D286E494E24F8B43A5B2E7D 1449425A691E109EB9E7AB365051869869A37E9626E9057A4673941BE259B92D0A6E4D09B7EF8C AA62BE2622610969A456C139587115A5817F144D02CB7B59683B85B26449160D0480215AEDB418 456BB6948C556AAAC6F523155AAAB19506115014D1C0535770478C0D172772C5D149AD06903E5B 9E81EEA891B4F981145096019C794B4E49D19A1E8C153E354E42039A74B980992715A88128BD87 BA39BF894C60171D4E96D73A04E2644059538E55AC8698667A42090FA4877493D0692EA069D196 E50BD200D221053460B212A3248D385A1D250145BA14250921A5B413A094F941D3348214E8BA05 B4A2C4D0219851A30BA5D2C4C96474B83A48C4E54199C51A669D3B38253E5465C517858ACEA46B 90A67951679639E56B83AA286E695085D1427B93A3173ABA1B945CE4279534A42B89226485173E 5190B1A6824385CD8174852745903B073919AE50BE7B48D422421412104593FFC2CAA69DE84559 945'H } , annot { { desc { name "Table1" } , data ftable { { data gene { locus "1" , locus-tag "SEA_COURTNEY3_1" } , location int { from 42 , to 347 , strand plus , id local str "Courtney3" } } , { data gene { locus "2" , locus-tag "SEA_COURTNEY3_2" } , location int { from 344 , to 559 , strand plus , id local str "Courtney3" } } , { data gene { locus "4" , locus-tag "SEA_COURTNEY3_4" } , location int { from 799 , to 2289 , strand plus , id local str "Courtney3" } } , { data gene { locus "5" , locus-tag "SEA_COURTNEY3_5" } , location int { from 2291 , to 2494 , strand plus , id local str "Courtney3" } } , { data gene { locus "6" , locus-tag "SEA_COURTNEY3_6" } , location int { from 2546 , to 3706 , strand plus , id local str "Courtney3" } } , { data gene { locus "7" , locus-tag "SEA_COURTNEY3_7" } , location int { from 3703 , to 5286 , strand plus , id local str "Courtney3" } } , { data gene { locus "8" , locus-tag "SEA_COURTNEY3_8" } , location int { from 5290 , to 5646 , strand plus , id local str "Courtney3" } } , { data gene { locus "10" , locus-tag "SEA_COURTNEY3_10" } , location int { from 6013 , to 6435 , strand plus , id local str "Courtney3" } } , { data gene { locus "11" , locus-tag "SEA_COURTNEY3_11" } , location int { from 6435 , to 6812 , strand plus , id local str "Courtney3" } } , { data gene { locus "12" , locus-tag "SEA_COURTNEY3_12" } , location int { from 6820 , to 7170 , strand plus , id local str "Courtney3" } } , { data gene { locus "13" , locus-tag "SEA_COURTNEY3_13" } , location int { from 7281 , to 9278 , strand plus , id local str "Courtney3" } } , { data gene { locus "14" , locus-tag "SEA_COURTNEY3_14" } , location int { from 9272 , to 11089 , strand plus , id local str "Courtney3" } } , { data gene { locus "15" , locus-tag "SEA_COURTNEY3_15" } , location int { from 11094 , to 11609 , strand plus , id local str "Courtney3" } } , { data gene { locus "16" , locus-tag "SEA_COURTNEY3_16" } , location int { from 11606 , to 12052 , strand plus , id local str "Courtney3" } } , { data gene { locus "17" , locus-tag "SEA_COURTNEY3_17" } , location int { from 12049 , to 12690 , strand plus , id local str "Courtney3" } } , { data gene { locus "18" , locus-tag "SEA_COURTNEY3_18" } , location int { from 12696 , to 12905 , strand plus , id local str "Courtney3" } } , { data gene { locus "19" , locus-tag "SEA_COURTNEY3_19" } , location int { from 12874 , to 13152 , strand plus , id local str "Courtney3" } } , { data gene { locus "20" , locus-tag "SEA_COURTNEY3_20" } , location int { from 13220 , to 13474 , strand plus , id local str "Courtney3" } } , { data gene { locus "22" , locus-tag "SEA_COURTNEY3_22" } , location int { from 13912 , to 14118 , strand plus , id local str "Courtney3" } } , { data gene { locus "23" , locus-tag "SEA_COURTNEY3_23" } , location int { from 14115 , to 14783 , strand plus , id local str "Courtney3" } } , { data gene { locus "24" , locus-tag "SEA_COURTNEY3_24" } , location int { from 14770 , to 14985 , strand plus , id local str "Courtney3" } } , { data gene { locus "25" , locus-tag "SEA_COURTNEY3_25" } , location int { from 14982 , to 15275 , strand plus , id local str "Courtney3" } } , { data gene { locus "21" , locus-tag "SEA_COURTNEY3_21" } , location int { from 13503 , to 13775 , strand minus , id local str "Courtney3" } } , { data gene { locus "3" , locus-tag "SEA_COURTNEY3_3" } , location int { from 590 , to 805 , strand plus , id local str "Courtney3" } } , { data gene { locus "9" , locus-tag "SEA_COURTNEY3_9" } , location int { from 5651 , to 6007 , strand plus , id local str "Courtney3" } } , { data gene { locus "26" , locus-tag "SEA_COURTNEY3_26" } , location int { from 15262 , to 15528 , strand plus , id local str "Courtney3" } } } } } } , seq { id { local str "Courtney3_1" } , descr { title "Hypothetical Protein SEA_COURTNEY3_1 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 101 , seq-data ncbieaa "MTEYAPMLPGFEAPKTGMSKLEQRCSQHLVMLQELGLLKDQDQVMAQLVMDLA HAVALSAAAGKAAGTALAVKPLMEALDKLPKPVTEDAFAAMMKEAGLV" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 100 , id local str "Courtney3_1" } } } } } } , seq { id { local str "Courtney3_2" } , descr { title "Hypothetical Protein SEA_COURTNEY3_2 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 71 , seq-data ncbieaa "MSTNPAELTFDMNFHAFVLAVPLRTTEAGMMLGQPVIAMNQGGEAQLVMALRA IADDIEARGTDVVGKWTL" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 70 , id local str "Courtney3_2" } } } } } } , seq { id { local str "Courtney3_3" } , descr { title "Terminase, large subunit [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 496 , seq-data ncbieaa "MVVALADELPELLAALEQSTARYATKPTPGAPNELGQILGTAKLLGRQLMPWQ IEVARVASEKRVDDPRRYRYPIVVLTVPRQSGKTTLMRTVLAQRALKCRNRKAFYTAQTGKDATARWLDLVKDIEDGP LSQFVSKRIAAGSQALTFPTGSTISPFAPTAKSLHGYTPHDVMLDEIFAHDAAAGNDLMGAIRPAQLTLPDKQLWLVS TAGTADSGFLKSWVDQGRLAVKDSGAGIAYFEWSLADGLDPYDPQNWLFHPAVGHTITLEDLADDADSQSQGEWLRAY MNRWTSTSEAVIDVAKWDTLAGALVPVPWAQVTVAYEVAHDRSCAAIYACWKDPETGKPALKLVQQGSGAEWLAPAVA KIYVENRPKAIGADDGGPTKAVTDNLRRLPNARSGGNGVEVTTLTARDFATACVAYMGHVDDGTILHDGDPGHRAAVE AAATRPMGDSKVFSRRHSRGPIPELVAATVALRLHEQAPATAPQPAIYMGRGN" } , annot { { data ftable { { data prot { name { "Terminase, large subunit" } } , location int { from 0 , to 495 , id local str "Courtney3_3" } } } } } } , seq { id { local str "Courtney3_4" } , descr { title "Hypothetical Protein SEA_COURTNEY3_5 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 67 , seq-data ncbieaa "MIRLDKTQFSIVVLCTLCPTWRALHNDKALALAAGRRHNLTAHEGEDNTLSAA RQQAYRARKAAAGA" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 66 , id local str "Courtney3_4" } } } } } } , seq { id { local str "Courtney3_5" } , descr { title "Portal protein [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 386 , seq-data ncbieaa "MPLWNNPLAKPAGILARQAAASVDVLAGNVVSWEYAEPDPAPRDHFQTLTLAH LLGVEYVNIDRTAAMGIGAVAKLRKTACGFIGRMPLIAYRGHDVLARQPKIVLQPEAGRPRFVTMAWVTEALMFYGKA WFTVEERYAEDGRPARLRWVPEWKAEFNTAGQLVKAYGVDIDPADVIRVDGIDEGLLNYAQPVLREARAIDIAAGRAS DNPVPSIDLHQTGGDPLTNEQIDALIERWASNRRAKNGGVSFTNQSVEAKTMGQPVEQLLIDGRNVAALNIARAAGFP AWAVDASVNGSSITYSNSPSRTRELIDYALSPYLEAIAARFSMDDILPAGTWCRFDYSELLRGDFAARMDAYKVAKDA EIYSTEELRAMELGRPLEVSE" } , annot { { data ftable { { data prot { name { "Portal protein" } } , location int { from 0 , to 385 , id local str "Courtney3_5" } } } } } } , seq { id { local str "Courtney3_6" } , descr { title "Capsid & capsid maturation protease [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 527 , seq-data ncbieaa "MKHAYLNLSAGLLTASASTRTISGEIVEYGVVGHTSLGPTIFAAGSITAPTPL SKVKMLVQHDTERSVGFLDSLEDNGTKPFAAFKVPDGAEGDDALTKAANGTRDSFSVGVHVQEYSFDDEGNLLVHAST LKEVSLVTIPAFENALVHDVAANRKEAVMTVEEMRAQALANAQTPGNPAVALAAAAAENAPSPAEVTPSAQPATAPTR HATVAEAQAAPIQVGGRRGMDLSAAANIVIEHLRNGLPATQLSAALSDVVPADDAGEGFLRPTFIGELWQAFNDDRPL IDAFGTPGKLTGTKVYGWKWDLANRPKVGRYAGNKTELPSNPLKTVPAESDAQDFAAGWDVARKYIDLGASDFIESVF RGATADYRLQTEIWFGEQILAEATEVAGVTTVLGALSQFNVEAARIGARLSTIQFGVDAWEEFINLPEAQVPWWLKAQ GSVELDGMKGRAGGVSFSANLGLGAGQILGADKRAATYYEAGSVPIRVTAQDIPRGGVDLGVFGYAGAIVHDPRAIWV SDDGLV" } , annot { { data ftable { { data prot { name { "Capsid & capsid maturation protease" } } , location int { from 0 , to 526 , id local str "Courtney3_6" } } } } } } , seq { id { local str "Courtney3_7" } , descr { title "Hypothetical Protein SEA_COURTNEY3_8 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 118 , seq-data ncbieaa "MIVTVEQVRTWLGLPASDPALEDATAATNAFVERLGLPMQPKIVDGIAVLDDD GAQMFEPAADTVLGAKMLAARLYRRRNSPSGVEAITDAGTSFVARYDSDISRYLKLDGFAAPRIG" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 117 , id local str "Courtney3_7" } } } } } } , seq { id { local str "Courtney3_8" } , descr { title "Hypothetical Protein SEA_COURTNEY3_10 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 140 , seq-data ncbieaa "MATDVITVGPGRFTIGSDTELTVFSGQVTSLRLVPSVDVGDSIYVLDGGEVSG DRTESWTVSGTMLQDFGATTSKTEWLFEHRGEDMPFAYAPNSARGKEITGVLTVEAIEIGGDVKTKPTSDFEFKLVGP PAIGTVSAG" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 139 , id local str "Courtney3_8" } } } } } } , seq { id { local str "Courtney3_9" } , descr { title "Minor tail protein [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 125 , seq-data ncbieaa "MGTKLYAVVGGAKLRSTLRKAGADMKELSAVNRDVANIVLPVARATAPTTSGK LGSTVRAGATQKSAIIRVGSAKAPYGPVVHYWHKGNYTPNPWVSLAAQKTEPTWLARYHAGIERIINQVTGA" } , annot { { data ftable { { data prot { name { "Minor tail protein" } } , location int { from 0 , to 124 , id local str "Courtney3_9" } } } } } } , seq { id { local str "Courtney3_10" } , descr { title "Hypothetical Protein SEA_COURTNEY3_12 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 116 , seq-data ncbieaa "MAQLSAPKVIVMLESSGTDELTEYTVQTDNRDAIQWDVTRPRRSWPAFNEAPM LYMTFLAWHAMHRTGATKLSLDEFMKDAVEVKVLSAAGKAIDPTEAVAEDVLVDPTQPVAAIA" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 115 , id local str "Courtney3_10" } } } } } } , seq { id { local str "Courtney3_11" } , descr { title "tape measure protein [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 665 , seq-data ncbieaa "MSRTAVLAVRIVTETKEANKGIDDTVSKLDKFERGLDKAALPAAAAGTAVLAF AKKTGDMASIAQQNAGAVDSVFKGNAKTVNEFAATAADKLGLSGSAYQQMASVIGSQLKNMGVPMDQVAGSTNDLIAK GADLAAMFGGTTSDAVDALSSLLRGERDPIEKYGVSINDAAIQAKKAELGLAGLSGEADKNATLTATMALLQKQTADA TGQFAREADSAAGAQERANAKIQDAGAKLGSVFLPAMAAAATAAGGMATWASENSTVLLVLAGIIGGVAGAILLINGA LKAWRAATAAVAAVQVVLNAVMSANPIGLVVLAIAALVAGLVWAYNNVGWFKDFVDQAFAAIGAVVAAVAQWFQDAWN NAVTFVQAYIEAWSIIINAVFTGIQTAVGAVAQFFTDAWNNAVTFVQAYISAWGIIINAVFTGVQSAVGAVADFFRNA WAVAVAIVAGVIRSWQAGVNAVFNAVGSFISGVVNNVRNVFSSVFNVILGIVTGVIAGVRGAIDGVTSTVQSVASIIN GALVAAFNFVASAGRNAFAGITGAIQGVIGWIQNALSWVRNLASGIGNAVGQMLGLGGATAATADAPGLSYFGGGDPG FEGGATSIFGGNTFFGAPAPKAAAPIIVNLTVNGAMDPTAVGKQIYDILLKYLRRNGDVVNGATPW" } , annot { { data ftable { { data prot { name { "tape measure protein" } } , location int { from 0 , to 664 , id local str "Courtney3_11" } } } } } } , seq { id { local str "Courtney3_12" } , descr { title "Minor tail protein [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 605 , seq-data ncbieaa "MVTIQEAALTVNGGTYNPGKPAAFILPTAFSGLTVSYGGDSCADHPGPGSISG RVFIPEQHSAFHPRIADPVHLRATINGDDMRMFYGTVDEIVIEDVDGEPLPAIIPNSRRMQSLDGWIVTTGATYEASL PTPATYLLDGARVSALGPTQGATANKLWFTTPAAPVSESRPYVVTAMAEAPSGLPALKAMWFNNAGGLIKIEDLYRWY TAGSFNGDFSPLRTQGTYPPVGAASVRIIVECELYANRESWQQACAVDGIVLHELPYGTVELPQLKADKRPPGRWVTF KASDILATAARLIVGTTPWPSQTVEGRTAALNALVPAGAVTFNEGGTRDPFRLLGPRDIDKQNMLEIFQRVLASSGDL AVASSNFARYVVAASLPRYPQIIERINGMATIVNDPLVPVLPAGSIVAGPMQTDITTMANQIRVEYRVVTDTMEQTGD DASAVYVNTESLAAYGAMGRSISTDLATVAGSRAEDKARRLAESQAQPFYRLADKVRLVSSQIPEAPNVARLYSADIG FGQLVYVPDAPAVLGNYHRVRGATLTLGREPAVELDVEPPDYSAPEALTFGEARNTTPPFNILKLSEFKNITIGQLKY VSALEE" } , annot { { data ftable { { data prot { name { "Minor tail protein" } } , location int { from 0 , to 604 , id local str "Courtney3_12" } } } } } } , seq { id { local str "Courtney3_13" } , descr { title "Hypothetical Protein SEA_COURTNEY3_15 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 171 , seq-data ncbieaa "MDLSGAFPKLTDADSVYALKEYSERMFTELDKMPRGIVARSNLNGSTAGIGAA VMVDLVAVPLVAGRWYKVEYVFTSVAGGPNDAIAYDFKKSAVNDSTANGTSLNDGSQRFVYTGPAAGNSKTETVRTMW KATSNETQNIKAILARATGSVAFTANSRGLYVFDMGTTAP" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 170 , id local str "Courtney3_13" } } } } } } , seq { id { local str "Courtney3_14" } , descr { title "Endolysin [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 148 , seq-data ncbieaa "MTMTLAYPLAEGETIQEFGARRSFYRKLGQLGHNGIDLGCPVGTPVYAMAAGT VLHAGWSHDHPWLTHHAGIAVLTHHGEHISGLAHLSKVVVSPGERVEVGQLIGYSGDTGTAGVPHVHCELLAAQPDWS NGYAGRIRFEFTKGELS" } , annot { { data ftable { { data prot { name { "Endolysin" } } , location int { from 0 , to 147 , id local str "Courtney3_14" } } } } } } , seq { id { local str "Courtney3_15" } , descr { title "Endolysin [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 213 , seq-data ncbieaa "MTYQYLTGQTSPFQSPRTQPIQSITIHWWDKPERNPSFQGTVDWLCRVGTTAS IHYVAEAGRVACLVSPDNIAWHAGDGGNGPGNNTSIGIECNPRQSDGDYATVAELVRDLRAVYGNLPIYPHRHWTSTE CPGTYDLARINRLAATPAPSQEDQMNPEQNRMLVAIYNALFNKKSMPTPDNQSIVGGEALDELINNNDVKILAKLEEI NRKL" } , annot { { data ftable { { data prot { name { "Endolysin" } } , location int { from 0 , to 212 , id local str "Courtney3_15" } } } } } } , seq { id { local str "Courtney3_16" } , descr { title "Hypothetical Protein SEA_COURTNEY3_18 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 69 , seq-data ncbieaa "MTAKPTPKVAAVGVSGALTVLIVWVAGLCGIDMPAEVAAAISVVVTFGAGYIK SEVTERDGKRGEHVAR" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 68 , id local str "Courtney3_16" } } } } } } , seq { id { local str "Courtney3_17" } , descr { title "Hypothetical Protein SEA_COURTNEY3_19 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 92 , seq-data ncbieaa "MESEVSTLPDSGTWTQPEVVRSLQRIERKLDNAATSGYVEAIKADQLRKDTEQ DKAIESVEQNYNKLLLMVVGTAIGSAASLLVTLASALPK" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 91 , id local str "Courtney3_17" } } } } } } , seq { id { local str "Courtney3_18" } , descr { title "Helix-Turn-Helix DNA binding domain [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 84 , seq-data ncbieaa "MASKAKCETTEYAGMLRRMIRAYGRRVGDADVEDLAVMLEVQRELDAAIQSAV DSQRENHGRSWADIARATGTSRQAAQKKYGV" } , annot { { data ftable { { data prot { name { "Helix-Turn-Helix DNA binding domain" } } , location int { from 0 , to 83 , id local str "Courtney3_18" } } } } } } , seq { id { local str "Courtney3_19" } , descr { title "Helix-Turn-Helix DNA binding domain [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 68 , seq-data ncbieaa "MTEQSNETTELVEADRAAELLGVSKRTLDRYQAAGLLTPIRPIQGKGAIRRFD AQDVQRLAVAQDVQP" } , annot { { data ftable { { data prot { name { "Helix-Turn-Helix DNA binding domain" } } , location int { from 0 , to 67 , id local str "Courtney3_19" } } } } } } , seq { id { local str "Courtney3_20" } , descr { title "Helix-Turn-Helix DNA binding domain [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 222 , seq-data ncbieaa "MSIESMAVVLHHSQAGGTDKLVLLGIANHDGDGGSWPSVATLARYANVEPRAV KACIKRLVDRGEVERERQAGGTRNMPDYTRPNLYHIKVVCPPECDRSAQHRINRKDPVSSTTPGVGQIPPGGYVPDTP GGVRPTTPKPSLNHPSNTDKSPSSSTSPAVNGKLPCWNCGEHVIANTTKPKRYCQSCSSRGLDNPLIPCKKCGSVRKR SYPGEQEFDCGCV" } , annot { { data ftable { { data prot { name { "Helix-Turn-Helix DNA binding domain" } } , location int { from 0 , to 221 , id local str "Courtney3_20" } } } } } } , seq { id { local str "Courtney3_21" } , descr { title "Hypothetical Protein SEA_COURTNEY3_24 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 71 , seq-data ncbieaa "MDAFEPYETYSMAVLWNMSAQTAHDAPVDGDALARSNWQTLSIQRQWERLTPC QVQKIRDNHHEVDRDSRS" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 70 , id local str "Courtney3_21" } } } } } } , seq { id { local str "Courtney3_22" } , descr { title "Hypothetical Protein SEA_COURTNEY3_25 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 97 , seq-data ncbieaa "MTGLSQTTVDQAKQTAVNMEAIANSYQKTMEWNRQEYIKDATTDKWPQYIAAL SEWQIHAQRATTARLMYEAIAHAYHLTEVWARCKALPTAADAAR" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 96 , id local str "Courtney3_22" } } } } } } , seq { id { local str "Courtney3_23" } , descr { title "Helix-Turn-Helix DNA binding domain [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 90 , seq-data ncbieaa "MTTRVQARPASTDADIGKRIERRLSALGMTQWDLAARLGLTQATVSRKLHGQR PWFASELVTVAGVLGCAVGELFGERCRPAVRPNVARI" } , annot { { data ftable { { data prot { name { "Helix-Turn-Helix DNA binding domain" } } , location int { from 0 , to 89 , id local str "Courtney3_23" } } } } } } , seq { id { local str "Courtney3_24" } , descr { title "Hypothetical Protein SEA_COURTNEY3_3 [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 71 , seq-data ncbieaa "MQVMAHSCWQRLPWSCRCSVAGDFRDHRVDGWPMQMMSMPVGWYIDVNESAGI EYPVNGDETAQRKDGQLW" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 70 , id local str "Courtney3_24" } } } } } } , seq { id { local str "Courtney3_25" } , descr { title "Major tail protein [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 118 , seq-data ncbieaa "MRTMGNSLKDIADMVTAAGVPAAVDPRDLNLPGAWVTPGLVSFDVLDVDTAFM TFDIYLVAPDHGAVHSLNSLGDMLAKIRPALQVGEAMPVMVNLPNHGADALPALLISIDAQLTED" } , annot { { data ftable { { data prot { name { "Major tail protein" } } , location int { from 0 , to 117 , id local str "Courtney3_25" } } } } } } , seq { id { local str "Courtney3_26" } , descr { title "HNH endonuclease [Arthrobacter phage]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 88 , seq-data ncbieaa "MLPGEWGGRAAQDLTKLCMDTYGWTCHLCKLPIRQGEQSADHLLPRKYGGSND LSNLRPAHRKCNYARGAKLLSDPRARPTDNTAFFK" } , annot { { data ftable { { data prot { name { "HNH endonuclease" } } , location int { from 0 , to 87 , id local str "Courtney3_26" } } } } } } } , annot { { data ftable { { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_1" , location int { from 42 , to 347 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_2" , location int { from 344 , to 559 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Terminase, large subunit" , product whole local str "Courtney3_3" , location int { from 799 , to 2289 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_4" , location int { from 2291 , to 2494 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Portal protein" , product whole local str "Courtney3_5" , location int { from 2546 , to 3706 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Capsid & capsid maturation protease" , product whole local str "Courtney3_6" , location int { from 3703 , to 5286 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_7" , location int { from 5290 , to 5646 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_8" , location int { from 6013 , to 6435 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Minor tail protein" , product whole local str "Courtney3_9" , location int { from 6435 , to 6812 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_10" , location int { from 6820 , to 7170 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "tape measure protein" , product whole local str "Courtney3_11" , location int { from 7281 , to 9278 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Minor tail protein" , product whole local str "Courtney3_12" , location int { from 9272 , to 11089 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_13" , location int { from 11094 , to 11609 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Endolysin" , product whole local str "Courtney3_14" , location int { from 11606 , to 12052 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Endolysin" , product whole local str "Courtney3_15" , location int { from 12049 , to 12690 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_16" , location int { from 12696 , to 12905 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_17" , location int { from 12874 , to 13152 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Helix-Turn-Helix DNA binding domain" , product whole local str "Courtney3_18" , location int { from 13220 , to 13474 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Helix-Turn-Helix DNA binding domain" , product whole local str "Courtney3_19" , location int { from 13912 , to 14118 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Helix-Turn-Helix DNA binding domain" , product whole local str "Courtney3_20" , location int { from 14115 , to 14783 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_21" , location int { from 14770 , to 14985 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_22" , location int { from 14982 , to 15275 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Helix-Turn-Helix DNA binding domain" , product whole local str "Courtney3_23" , location int { from 13503 , to 13775 , strand minus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Courtney3_24" , location int { from 590 , to 805 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "Major tail protein" , product whole local str "Courtney3_25" , location int { from 5651 , to 6007 , strand plus , id local str "Courtney3" } } , { data cdregion { frame one , code { id 11 } } , comment "HNH endonuclease" , product whole local str "Courtney3_26" , location int { from 15262 , to 15528 , strand plus , id local str "Courtney3" } } } } } } } }