Seq-submit ::= { sub { contact { contact { name name { last "Bollivar" , first "David" , initials "W" } , affil std { affil "Illinois Wesleyan University" , div "Department of Biology" , city "Bloomington" , sub "IL" , country "USA" , street "1312 Park Street" , email "dbolliva@iwu.edu" , fax "309-556-3864" , phone "309-556-3677" , postal-code "61702" } } } , cit { authors { names std { { name name { last "Cornely" , first "Kathleen" , initials "." } } , { name name { last "Cabral" , first "Jennifer" , initials "G" } } , { name name { last "Wheeler" , first "Ellen" , initials "C" } } , { name name { last "Cullen" , first "Nicole" , initials "M" } } , { name name { last "Bollivar" , first "D" , initials "." } } , { name name { last "Garlena" , first "R" , initials "A" } } , { name name { last "Russell" , first "D" , initials "A" } } , { name name { last "Pope" , first "W" , initials "H" } } , { name name { last "Jacobs-Sera" , first "D" , initials "." } } , { name name { last "Hendrix" , first "R" , initials "W" } } , { name name { last "Hatfull" , first "G" , initials "F" } } } , affil std { affil "Illinois Wesleyan University" , div "Department of Biology" , city "Bloomington" , sub "IL" , country "USA" , street "1312 Park Street" , postal-code "61702" } } , date std { year 2016 , month 7 , day 7 } } , subtype new , tool "tbl2asn 17.1 - MS WINDOWS VISTA" } , data entrys { set { class nuc-prot , descr { source { org { taxname "Mycobacteriophage Penny1" , orgname { lineage "Viruses; dsDNA viruses, no RNA stage; Caudovirales; Siphoviridae" , gcode 11 } } , subtype { { subtype lab-host , name "Mycobacterium smegmatis mc2 155" } , { subtype country , name "USA" } , { subtype isolation-source , name "soil, Providence, RI" } , { subtype lat-lon , name "41.8433 N 71.4346 W" } , { subtype collection-date , name "27-May-2014" } , { subtype collected-by , name "N. Cullen" } , { subtype identified-by , name "N. Cullen" } , { subtype other , name "complete genome" } } } , create-date std { year 2016 , month 7 , day 7 } } , seq-set { seq { id { local str "Penny1" } , descr { molinfo { biomol genomic } , comment "Phage Isolation, DNA preparation, and annotation analysis was performed at Providence College, Providence, RI~Sequencing by Illumina to approximately 2638x coverage was performed at NC State Genomic Sciences Laboratory, Raleigh, NC~Assembly performed with Newbler and Consed software as of Feb,2015.~Supported by Science Educatrion Alliance, Howard Hughes Medical Institute, Cheyvy Chase, MD" } , inst { repr raw , mol dna , length 50884 , seq-data ncbi2na 'E692563CEC6AFD4AFD8EA8E84654A0A55BA229D22595D9A987A12 206AB0EA76165A46A5A44A944489621158CBAC84B5680CBB478EE9C7B44752AB52611D8D602ED9 51CFAFB2AA0888AA05C68AAE223AA5D95E9DA5758A2595509A755D6A2656899D55D4321697D8A9 6B6C7E13205A5D4A96B35269752A59F5A699D1619965732A2BADDBEDFAD052E16B4159715861E9 594C6884AE75B866A7A37B88DAFAD6BE5E7E29858AD85135B6EB8614F466505C6259B9DB6E51A4 20B4D678A9065682692F1894A2826161606515E964CC9A94A2567851528AE12EA606295EE6C06B 68D066D619040866B951620AD16536916E58C5627EBF618554D536D2217B36B77858B49906D9C7 1896D61E92C6568499D47D763A9D742D5609506B49C74516D07639E24975DB758AB85965AB507E 23626828258A8B6CB61BA648DF588DA7A74A9C122159568AAD896D5775AF5575AA7B13461980A0 2523A784FAC565D8498F67AD77A66B661F42E86F6205D865269895B41F5692915EC7D89F487D16 0858BA8BD84DB6A96E946342B62D858658653568D9142E9076DF5D5A3AE2937AE9856FA6EAA16D D82BA9E38A748A7F54486B0B69DED71B6919616908DB6AD19525F4978DD6D5458A5542A6D74566 F656D6A6DE76A755A5536A590A579698A8751361A52BA5871861715976B5586988DE8F9E9ADE7B 1671869AFA5D58A5869915B52AED8AB590ADD1EB592AD6169590AD64A95D0A566EAFC5A2316959 0A624A85C5AD4429542A211ABD50A54429582AE1128565A54129545A21429592AE34A93D2A4D42 85D0A56D6A582AE1029842A63169055A5616B550A2116B560A964AB854A144AB582A6112B845AD 542B542AE316B950A564A9BD2A164AB524A6D5B5D81A46B9D87DB427854A79718667B5582B6618 6F71B8DBAAE1A3A63D8C6906D056066F59B29152156D1A37D7A90614ACE978BD177944490C4512 5AE4F46C61354941E5EC5D84D36D76926B9B9AC2A4E4BD36177AA94A69A67A92E81D6D15D21BA6 D8CD5BA26F746B45A47B6842B296D41A52A6625D96B055145987345AF1AB6345AA6AE9B25A0BDA 4A6BA5E8290B6569051B4A069346C6DA699E742904DA699A9054529A69AE525114D17DA89AEB9A B941A36B7ABDA9B13706418482026B90F940551811628718BD97FE7D8AE0A9409B7DA819635A11 BDC5604D4B1A71229921A6255592534F4A6CDD84177A4A485287D759376B5EC6D956B86E86B8F8 568E1BEA11E52BD8F8A1C75F6A38EF61B6E84126D8D75BD37E8AAC663ADA21A66C68950C494BD7 49F718A90A59E4568DC7B590562BDBB191608D97AD45EA0F629B0D975A5E15161E06AD4F8DEC9D 07A48915A7BC16ADBE8AF62D7548D253989AF5E5B268A257644CA46C9D0FAD2249ADD40965A792 BD8B5E5BB7905152F57EEA9EBDFDA76B29032902597B74A04AE6E2AF61D5D589C647E123060289 15B9D90536509E3654A67DE58D366092367862F69091BE259D14299EB8596D160965946A66899A E5842785871355A4676385234D85536E08AA9E88DF5AA5E198E1A20AC7D5C6164936D592885A7A EBBA579A5152B6E741D98A4D36D5A29467659E236294D8815686AB861661A45871B6978D892B9D 85966D5A7959C46DADC5E1418565464A548285A7BA89136D6753419A9C69B6D381EAD9565B6042 519AEE0A9DAD256671269A451B1471B66E4EA71861155A676A4BBA365849A7D4964A9C7A376FE1 4B994678D5960A9C66C658659169E756456458556EB6196658D7A66E79A93758A50A566235E586 39B86A7824A5879145B4168D98EF4D952169462D6187D6A51628B1941AD57A14A267A3710A8645 E8F48D17A66247195AF6A0BAE7D859A5EB8585586EF6D08159B99E963782EA5A4DA6697AC7A1AD 8995A1341B9EE6165984D886B7661A341A86056045A1994144D82268D959E81664766B6B86179E 41F3588A28A1A7DFB591D1159E04999DDC4188D3820AB5856B6F4E96285205236219E769F6DC41 361A4137A0619AE1599717BD86E51E9EF8B1B6266F9D9869B51582DBA9BD492761A42A6267A7A5 0BDA528B1E42A5E359F4208278185E7E25B1AA2078E55E6ADAB6061943169A9EB896FA48218E7A 56719A5C650A6C61A6A59E62D869CFDA718619E1BD2662C606591514AEB61AE2B4B86585D6A77A 97A29A6099E9EF46B51A45A1296159EAD6A1D56584699A9AE7610B117A4953690715676A6F563B AD7634E86B94A89F67548D9B40B5AE2B417A6A71D90A66BADB694AE74246134E8560A925E45129 DA63B590ACB9DEA80D539948AA0D9D1F638BA3D15AE929521DB1A4D76385A760A9E882916F6235 A8719919EB84EC65D4D1A1A610A18B108D98DE4236D38698687DC58A56075BEED5078D89FA126D 67458A93643A57A634D84679AF7D181166469C41368527361F5E6C9E1F84881E228A8EAB897630 5345689F956DD5593B8DA971BA9191ED869A7AC5E562086769EA9B5E07AEA79B1B42155A6B8919 E9D96F4E5867A04A76BD19EEBAC66B63841A41C6DC598A935E659742A7AA42856F649667767668 1DE6956C97DD91F61921A435AEA425194659BA34536596D252852182046F767BD58D38DD8249D0 22871A9E7AD05AF4D371D62969A99362964176D55936B60AC16561BDB4D8818864BAEAB9285A9A 6234186B466391A64362A4178508D56B95B65E98DE41991355A41845BA588287A866C5284D7B6A 429AD845A4E7718657A29559E1156B7588D57648A823562A7149CA4D0827588A9362365629876C 7A796B6188D78ED8D7A13420763458B46990BD74148D0654E28F6E8DD16062E816B94952463D25 5D142AE168D19DABD86AD82D4187A1657EE9B96AD8E1A8EFBD78D0ADE81562871889AA2B556628 6E86516D6763BD949C61BED93D66586E0A2F629B1B614BAA5A87D64208D4AD066155A4158F97D8 4E669484098F65F61E626BD7A19AE362422B7D461A415AE782491B790646184D41C5C6194D98F6 429490A12690823E1965B799AD766F699884A1F5E38B09905915A2A6B8E342E18955E4824A206E 8568829598A239D05DF4689A19085DA61046971C62D6265A56196CA6D1AD55248E48279D993B69 CD569DC4D8653649994A27E2A7D69DA6A9630A58624BEEA1EBA4A5061761362D867E94458757AE 4E96B6C4D18DD42521581361569BA1522B5634D6AD89458505EC6448D856645612B8E62535994D 8A18A0A418AD36A9467B17960411AD37A0598A1A52EAD4AD981B664417A23AD5AD35635504A1DA 7B685DC6918688D15689F676B458649E568678E78E4A61E489E3A9B5549A79EF69B42A6289EA6D 855885A5219EF619B17A764D7A6F628518350A5492F499E689F681F6E86576199E8D90A7966C45 A9E556C717B6F76DE20569769E294D6B5DA22587AE086B6268204237DA699BA89098E66E9710AD 381A6984D5168B1C5A3A2D8DE998D6D86586C65942921926142771041A52A6E3560A06A764D84E A71D8D16066088E682EA18A2892912A5EA5D3A914EF6B1615B5AE8AC15A10568065E25525C15A7 8A29E79B86FA08B19654129AE376D66765071B4E6FA942F7D943566775BE683A78AF7E81E7BA56 2B5269ACE28379657A5685F7186741991D4515A27A154188AF9ED627DAF62EBDB9204E895919B4 2F754A28A5AE1929BA54AD99C624B9982D88E92865848D36A9AD0218559D564D3D9ABA998BA51E B62217B97AE5E39D37562A5EEC5DAA5141969721763861DA496238D9E7AE28ED262C4E892E9196 AE61E40BAE5ADF42BA187A56BFA095209A9DD6BEE8D864A99826D5AF8D8B6A4295A14104E04288 648199D6DB65D81AA60BD93B583D9E79E49B2F4D53509552BAA7B45CE54A290D413B58C55C6145 8C5565986850A528960AD886F496A2C6D8A8759D209656716418820A39AD8A294216719A9E2B6E 0A0C6259236588287664DDA07601617B590A8DE89F7423429AD7819A235626086E763B6E15E352 A45861845B76889B422AD0A479EAC2954980D569BD8551D2AF6A4945D59E0690567DD866742664 BEB9B88955340C288C10413A4A371ED589152B64787AE1F7697D7875624894A1C7D9A2362085D8 FB5268D9590AD58EAD616934935547A16B96DDA6DBA1698A58990963450ABDBDA424A07A25AE08 D14637D92226782DB9B74159D07178114E68508D96294D99D0BD8669E5351A4D8425B79BD0A9C5 E9621850ADBB67A584505E1469B6AD64A9065C5E9AD04195ED9D7AE049A420BA16915E7A106D16 258D7411A6B61A41ADB5DEF6E8B61711624ADA6635B8A964D7AB6D5171B66841BAD06916FA4166 EB69B4EA61F494AD37AA52369ADED7D86E1614A515E87DAE2812A69BBAB9509E3767BA49104EB6 7B5BE609E2F66F4EB41842866F6E09E1614AD9A91A15608A2E15D9F84881A96AA5C8955AD7DED8 75B28A44E08D6112A5069A7D985B63862126882F8D95FA4CEA26678655805A5D55098D55619652 6269D2095922955041822E2B884E5B19069B586E1356FA91B4951E182216678D06D6FE9E3B6268 E34269935685E9450AD1615A1C5D8217424AD8268E5BDE69FB5B0558A9C5EDA2161A41C46C4E75 ADE176526A09E88DF558A2EA235EA71648DD9386B8DB560D6B8E584E24DB4DA2909D3619490B9B 62860885A62262451E6D461E98351EA906E8DAAA5A3897DD8E9AD59718A1B8DB715608ADB45862 869045485654D42169356942998F52B90A52D6B1B69186A58928418A9F62D620ADC5A39AF56675 EA1962469BDEA674B588D8BA6E8B9AEA677DA23B41F71049DDA645959361C46B826B1E23A529E3 6948294E051B4DD517A3A6D0A196DCE58A60A26296829629417A44A5664D8667A44237DA968D17 862AE16D158A63B61DBD3417609950E63A5362F694525B5AEEF69569A4EF694DE8C5026522A5FC 4D346D679EB718A328AF593A548E559B5296DB5D58D75A9A679786E0AEA75E8D8A1361C591BD58 EB41B4A66DAEB51B4E218A52109D97E5AE3623859B1A9B8AB76F8858827718219DD826771867B8 2450150195969CDE4753428063A99064BF2747BD4A1D7A6AD4A874D49DAAF654588D78C1547744 288F6533A47838639AFF859E5B69C6EC45956BA91A79961D79D274219E05E1611697BA196169EA 124DA511B66E984E562F69F61AEB8458AD6ABDBA4820827998AD1858235AD8717867BD7914BF8E 24A6FE27B1C699819761465EBBBDA6DDA7989A615858829BD7AFB4DBA1AE189BB69F519510A6DA E65A86198D49D5C6861F6799E5AF6A417D79244106079EF76E8D0628DEF41B62822822C25E5DE5 F848818785EAA8AAFD7E9A97D575553444DA56541FD180AD673B406CF47761DBD6608A58598BD9 97B427A27A8A61865B6E75906E7593D2086659822BBD49DFA209E8753660A1862A424998228617 6194B88E8263A984D99E68E3607ED9210619DDA896BEB6381D66185D9BE15D0ADF629BA3819854 96AA0962676565E3E1831A61E5CB6785DEA21B1A6E8DD2A13717578B565DD5509D95EB5D34289C 5ADA766BDC64882669A424BD6A8EA18B62B199EB6436D066B9891D431171BA6913D42D82582594 855F541D54181C091A48D642969D3D93A3A598248F9A795808A0A4485C3B4AE8929A5282DAD937 4BDABED58116347D64849D08549D8253620B6399A62B693E9983781D829647674BD96638E9A639 89859EB66BB45B63B8116169B92548677579D661A4E0A1EA966574186B61E96DD81F5A66278148 E19D95248A81959E781446C65C5D0B6B4188E658629981C6D6E2F4586571A1D24A7E9E6524A108 57869414A763A0B5E8E3A635886606D065141A7D642F524A6799A4E676A6926B8EA5E8A9DAB63B 569EF769BDA6186688296B252B2246DA420BD7697856CEAFAFAD129B7DBA69E45653697AE9E975 E9EB755D9D3699BDAE5AEDA67BA67693A1A8D0A692582578E526F6248E0869ADD6AB7D892A5D09 54BD89235D98E39639D186A4E4A9BA74A93ADD4EF50A6D16191E9F5A66AD795272204D7A504508 EF7D892F925E69414BD192DBD7857A5276A75865F69C5ED6AD9E046F661D2F4188EB816ADD9206 9B4E86998E0A9776485761A6D1417BD15A74E8B5ADE4A63A941DAE859E041F5D1AA32B8DE9AD99 E39499E176776A5E36906E769D1EAC69DE9D736D1A6746526F4519D9A119EA7679EB9505E48676 904D78656C98538DA4619E14699E49235258EB55A5EB6207D9D27690467AE1417A459135695D94 598EAD23A6A76B4D09D9963BE3494BEBD69BD36178D5B6B4641E79746DBB6FA78A6F6460E39698 D79676DD8D37D25DBE697D9D29A494536BA6FB5EAA6376D9D368B4DD62B4D182BB683ABA527D99 2A66DA13669429A489C5693AD0899DEA637A9DBD7AD8B5AC29BE364ABD958A4D8A5ACD85E9EDAE 59922ADB6892D6417BD5BDD569C28295BDDA9629EAE271DAB4B7BA9826F658E93822464A924DB5 21A50A234E4A598282EF698E5983766F41F41F6A48E48948E976766845D928DE68224E9A926DDE 99C62540423619221590A23A179DDAD0828627A27A06D26DD48E8820521858429660A495D49264 D86079239209249D81E49A4923A1C52982C45852B75985A4B8B18617DE0421A76CE57187D94A94 41A34BD7758EDA8DD6986999DDD299D0A2A9E0BDAE24BD37D06DA763A18A5B10A524863520420A 6750F6128AC04A3E8C5B6F81D82AB41A62EBF15C96B54182A85AAAC45DAC78EE0AB77D8565EE02 EB318A25AA0715699DBC5D0D168F7DA661345FEBB6235E0619E53E8541D7A7B62A1DA0E990A6EA 6F61661E427B3B461968F5A472B178075AFAB8355A2B767711615590A908D45AB6D3ADE4D92985 6F7AC62863B46C459EE192821186F6358151D5BA57A5828A27971621BE14D1AD8568A1A42AEB78 358585258DE9E0BA3DC5E9D458A2567896C4D569356EBEA67581D5598637A1AD5A1C76F4582495 2981699358397A5D36BA5E686E62B5048D25DB698D61A9A46F6D782F42A611449A536564198796 61AE0B665E8A675624DAA5A41786B36AE950679D2564D25BA66ED3D1EB861F65ADE5125BE3509A DDB67858498E98D5046BD506E6AD8591868A9F46946522066BED8C58566EE892B76DA206925277 A91A381A6D6BD4415AD596C460B6086F62347B89A26BD6A923ADB9D6CD51A93A1CA57AA9D83894 6914D1867A2867059B7A045B4E9522A739A8A581A7425977AE69DE81A613AD7DAA6EB67A626EBA 61F62F4D801847A449B63D27767A34513A50BAB8E07D0A966109A06D34D14D8424A895AEB5ABD3 A34716AEB598A2069879C5D86EB7D09187189298244D76DEB9056F5E65689E4BD5427BA34DF6A5 E60BAE5E79E19EF6D04D75876018B7BA19D5A10567615448BA396789F4134907A28136D096F567 5DAA107505E18FB7DD99F52DBD461BA508219D4A199274536EEDA671751A60856456F628DE6698 9E04DA567608DEFB674D58F691A797ADEA134D841DA9EA92E2165F69A75E9E1A9F4D6A6BAD04D9 368693858A9361BBD1A98561BD5698B1C465BAF5EA85D544A55BA36EF62829571169342D768BD0 B1C629478C6D7DBA6A6B8B6394A6D06298DDA69AE04EA2987D745D9E341DA63A6D5DAE4B69AE53 617565DEA6938E866BE6096FB1881B7D7A5F528B158675B9ADA4E59E58D59E7A2149886A5EA61F 51C718ABEAD8819450A6F467B49BD7A614A94237A8852A644695114D0AEDA19E75B1C6DAE0569C 6947DE9DA3766FA4416F769FD6356845BBDBA26ADD42369C59EA10A1A560A9EA17A2369C588964 A156F7827BD89E3522BD0689CEA527293DEC060060291944E3C2512820B61E820168A247D9BA9D D64139517D92BB699AE1535AAF5D487EB40917BA8BBA7D9536A1C7E8927E78E286804D46D2C279 509240D6FA4A45BF62B95B2C7C4106499BEAED828465A558258E29F5E1BDA41E1D24A2062F4E79 94B16227A978D061C4D592661164420FA1E290640E9271218C64967A178989EF63861063769781 81EB6A3758608AE82695A082B5689599EB99AE934E96DB697AE97D35EA4248D84517ABE25AE3A1 BB1B6D9E755E99D9BAE8F6D906E195B680916A7D3845A9F6350687ABA17AD97198D78635590536 B9AD966E992D1482BC248647188D14185187604D69184F8617A78A5B5B8AAF5988D64284DAE979 98A279A1A264D89A360A2169D66DB41E42C28AC1AB87156056055041A17AA589F829E9DA47A64F 62329AEA97A071A5287D162925B5A88EF627D698D14DF4199D8DE76089079E08E55D826782B7D8 9678D561B8D8A187D963B67DA6BA508D36115E163A979A579E6AB8BD8E2E9E4A11BDA26766162B 5342D7A235E9E9FA5B4558D07516D4A6B8287AE8548E175ADEAC39AD121785091341046B810BD7 A9786A45A511648A39A79663A918DC414AD6452654927D085D3A58921699E5476A42DB1B6D27DD 4139506A5BD5498BD85E171DA91691E9C4D98D4A1A4296DEAD0AD9E1A61662B8EA42C418698457 85871481376A45B650563A106998207ABBDA99E41965086271B719ADAC5641D5E761F5B9607A9E 6EB69A6D0B1BBD94506D5A505607D05DA6E08FA06A42A9E281F52B4DD6B060B4D361C468459693 494ADAE60716A9EA9F4D276149069A4106D5654A6B5E786E75864855D81945A76AE600DD9A781B 65074A6D266A1A4DEF56981F718761637A519484D36E85B181A82F469B47A7A7AC59E62369F59B 815419BD7899BA07B956B4DF4206A1AE4D8B681A19B1E7DF71F6936B9299D9C6648527DDADC5D8 64A61C6D425AB1866A52951AB674D1AB8259E9BA2171F4937471D04A25DA30E424B621448A5B8D 4A53760907A982BB858624AD941B5E1E678106E085A6256DA4535A6625251690AE95366D826F69 B504BA6AD2E8561A624B10617925867948BA91D37D8D5165E31180895577428FDAD76A2AA9FFF9 BDC5AC8EB79B7EFBAFA23651823521523535D6089482B4A361049239266EBEB7DF69345946A78A 6EE67A69E26EA2B51DAE5B60B267B5E99D676AD6AC5052BEEBE6BEED36E4F57DFBBE6BAE7A62FF 84D97698C976D989F48A537AC7D36531AA6EBB9542685341D7EB6E95597A9A6C6D9D51A668ADBA 15A2B6B5D58DFA4C95F7E2626AE0E687D8C9675578B6EB8904A977A55FB937DF5AD7D3B9D5A14D 9661BBA691AD16867D89A1ADFAEF9618637DE9619A96655A645681F4DB465B6D4E3B5F5A60DD8D 27558164A76D46628AC869456B2E74E85DA7985B750F5EA9B889751B6676FAA97DE7635A46AF75 88927ED761A6BBD38695A28EFB29BB6199EDAB9E3954E5A545195A18A9E9B4DDA6165BB654916A C8D67D7A6EADFB127566D57598A599D2E251F7EBB1D7616E3A28E697DF7E959DA6A69B52B75376 388699DA0F89467D66D4D6BEDB2B792E6CB16465B526AE86C619FA3DB59D64DB7D26355289B6E3 AE5072B55FDD58488AB163F90773E41D58AF4DD9E4185E43F7F47F82AE4DED62B00161DE1B9E03 3A3378457C7D4072719ABD8F56D959D64AD2AACFF6557A5F79FDE2A1390771E41D5789EA6CE57E 4DC2A46AD9C1F51EE0BEC2D0095785E65048D2A92D1148CA27AE4E28FB746D222F91E22F905168 16D92DA29FA5F65776F4699D2627A4925068B65426E8EB9576CB61A6A34DB651A6985BA5787691 67AC65E8579E79DD7676DD6E96A06E1519D2591AE5B663AE36498D5567BA75E9671D1786B8E7B5 6626F6881895BD6BA49A0D5D6CD9819A7E1E656B683139A3DB933B68C4000A7A55756B80A2AA74 934E6CBE58EAD9341D761A289BD8568D25AA942DA3A5F8B6D6D263B2F9A1AF7AD84458AEB7985E FA3A39992E92F50F5775F6B4BA39A19E26F59BE8A781249D8EDB5D0AA42D562BDB4A97DE4BD4A3 495A237D1D2345D7E28DDA51B5D86A49196576B8604666A6E9E7669A62668C885D8258A1B22442 B93D2F75EAAC0E1BE18F5A69B6349FD8496D92AA76AE3B22AD9D6388D7773643124A9BE97693A1 E51936151967B6CB67075683E759CB5F62A46C7915E8695928996F335AD9DA11B6B7F861879161 DA75DD92DA368D945B7E98DD0A0B1D354EDADD122A14357F5B541A1523A45A2635A5D556C8A085 816B52E585FECDAC5A7491D2C8236A58E5EA86C5446691B238D5B9AB2BB6DB6DBEBAE76DD94D12 9AD29628D3A61A528A39698F9F5F46AEF5FDABE9F5E2153E66A14AF67DAFDAE6A7EADAE8D39A09 E1F6475B62C62D4D6B2D81E2A4AD249552D7557947A152C785B6D19F7638A2CBA7494DA7D89F65 74BD66F752F62F598D611D9B8356B6CB4998D67DB52A78BE25E6AD2B7988496E869A6382D64D25 D9EE8BDE098E27D6ADD7AEB6B961BA166C85F52697B96D7EC75DA135204ED7E954B6FF61479EB2 24AD82074637D4DAE375FD639798B1BE6821BEDA5045D79AC46AFE8EB461658BEB7606379EDB6D 261AD19AC66A9D4AA376D4D2195E7D26514AEB628DB7A975EB5F7ED8DD95E49D99E7D6A6E82D85 EADE15E98375FB507A18B67D84916638DABEDB7B4D2C75F667B2181F8A576AB9F75159D5AC85D9 606658D6992F5E8E979E759B298E976A2D936E6B96E0869AF92F74E7D777BDDED0B1AB482D265B 226255185B5D6176AB6B9618916854DE7694D29A98DD7B99547997ED25A0586508DDB6E8DA4A60 AC9AB815A5D3925A3499595AD1B6621861E0D2B2F49962CA56E2AB516925A6D6169B863BA57DEA 19F537A27E69E27DE475AAC656B6096D85179FA49753B5216B79DA516DFA45165B215E582F45B7 E931F59D6A7B5FAE3756B6A519A5665B4D2B9235916D5E065E8D36D6B656126694A19A2F5EA5EB 2D86825349D95DB494A0916581494B459EA49B78968396B8D84E625B9897926AF8E7A6E926B5FA 2D5E7B6281FDA152B7DD51F9547DFA5DE2365D26268D97D7E3416B524917ED85FA9E96576B99DA E37E195699349976985E8DAA2F86F75256C8A3B697E7654B2D79F5924ED76889F767B1D46D8928 255E6753B1892376989FB9DB2A45235E61163A4522A349F7A2C96E598A36AD4E566C89EB2CAAF6 D47617DB523B997DB6DFB3D5F949BA534AB7E1BDD261689B63B2E7E141D7527EE563945F5F82A5 EAB514AEA528DF6EDAE17DA513B5D4DA8E549B99D8E17A2B6C619BEE8918157E1BD64B97A6A5DF 5DB2628541D85A8D1529F6F68BD607A1CA6906835B67B23B5256B6DD6ED4B58A09523895A182D9 A09548AD35DBDD4619A3461EEB95985D396B9D0D0AE575F129DE4BDAE0AF9E607DF812B79658A6 B7AD755A6D85262D52B6538298694DE85A79D29A6218A39B54B9BE38EE6ED4F5775CDAEB239568 6358846BE6ABD1B60E1D663F6979B8252767D34A64EBBE1765AA841F7E6BEDBDE66949FD9F4BD6 EF756051B5D85236F8D1A22BBD8B262F2116FAC775D858689869B2C4A1BED52F82F4EE6559ED96 C8624B89BD619352652F65B81B814DA96D582863AE375F4EEF5DD2CAECAAB36A8ED7ACAEEA898D D5A279F892F65E52A068DDA6D25974E526A5F8E1B265395AEBE5AE18536B8BEB4EF6928595E967 D9A97DF585485A5DA6C8EB862F6DB197699E9B9E8DDF6209D7E99A0B259B56B9B6348D7E1A6A6B DBA195075B6AD86C99E6214588184AE5EED9D09DAD28585A7A5D8EC81BA67A6E75286774E95136 28EE7E2B2D86F7566E9AAF6869E0616B24BE697981D662F6D258E3AED562D76C96B96952CA8DF6 206BA398D2FE1FD3B9D5DDAA2AA529601525575BDDED0B498660F4A0799B44F6DBD6B459EF9218 137AC69F96F7DFA219687E07D3765BA992C99F755BEAA5D78965E6B99D87977AF945156BE516F1 65949A9E68949F66065E959BDE8562E049D95248996F76585379DB29B5E4A7769BA386351A26D8 35AE595F82B49185F95DA2A66146FAD17E92597DFA5AA5F7DAA5D26A6BD36089877D29D6A9769A 8165EA5DB6DA4AA58260AAD8D36D31FAF3D5FDAFBEB8F49836A4265BE992D74D875369479FE9AC 97BDB1E7BFAE359DB1AE5E693A1976A8036F955F890D4581B192FBE1B1B4DA6FB1F36A361BE9AE 061166FB695234DEB1365E81949376F4AB4BEB7961D06235DE6D195B167E145DA618ABB5E6DA8D 8861D6B81FA6C88DB5D85DB2579656CB694935AB79DAAD9D3610581D968E0B266208DAB8355DA2 114A4DF663AD56EAA516E67DF46A45A8E689EB8981D749A5FB6174EA50B96491B5681A1E96A976 8B177E5AD3652818A51142BA58658D69AF5AD49175761F6AD66175882B6568D2816AE3497B997E C4958ACB517EFAED7568606694AF86E952BE4A9D51AF626E376511ABEB92185DBEA75586F61261 8B5482529D96FA614E576B8DF9A28EC759BE51658DF459B5482D7AD85D4588EF6DB52E615AEDA5 F8D58605AD8DE6ADBD4B934D94E62589A606594985111E663A6EB635536588D5B5299D56DBA98D D9E28DD931B6349358948A49A558A5B96581B7D27D9960786856211B6C8667A0BA785D356B2EAE D8D2B51489269525776A2D7518E0645254B6AB6C75B612865A5D7D365DB2D6AEB5AB64863BA1B1 275E781759B2DA52836BD8B2F6558659657538964E06E0760BAD62A7DA55495885492F822B9EA6 F7D19786544AE9B516A8A37E0B5D4D25A348D766745B62BAC99DB514994AF56D85199645BF5A52 B75F215B6A7EB5A8B2B5AFB2149D57B6B552FAD19A75DDF76376F9AC81D7F9A5D9659204A2DAD7 7DA94BED8D24DA7DD39A022B5A8637995AC4DD62595396F81F66D8239ED16F4DF6A75DB1B89294 999EB5D423A6D44FBD256B9AAB63B3A3667D1D52175F76166FB66B1EA6A4A168936FB547887D84 6C989E1D5A60687A62E5EA5B6D1AB86EF615E6856BD376DAE2A6A46959F49178876775875A81D3 604AE99F45166D66C65DBD61D7419752E6FDA23628D9E2D0DA29FA1D96579A7E516DA2DB1B7A17 5AB5275055F8A9D497E249F7E1769498B16B2795FB2CA6CB5B59D7A7A637AE1535E14A058D7E97 DA75296205FB51AE5688F6249F4AC89B79D4ADB69763875694798A618DF65959F8DA7E74967637 EF77B42ED2175407616D85B816976BA36816FDA5F86E4A5362AD20A583579E52F94BD457E2B2EA 5E993B534AF96175396B86B7EB46D965B2581BB986235529AE6EE95385122B4E07DF659962A6B9 D566F7AF4968E5946BA5BABAD15256B98DFBE074A492B63560D5D82D892BDD82F82055DB1D252A 5AA6C5AB8AC7562964ADBAF97DBA39606A5F6C8595A178D4A079F95F76FB9D59359F66075D26B9 5F9D45A969B6ACB534ADD63BA241E35A7ACB658E05634A87E16565ADBA06A379BB678E186399F9 D12B5D40537A25D86A75DB2399D864979B25663B6B018346B8C94B57F857A637D34A34D2BE946D 8EDBE369E962B15620499663B5982F7766AE96CBDFBD76A5B834967A977D4A39FD9D1DEC5E5DB2 37D849975DAE58AE5D2658499BD2EADAD416B45985D062365BEA82F8A5866891BED76F476D55EB A1B2DBA195DAD4962F6DC6D81266279DEADBD388D7F524895BFADE7E3472E2F46DF65EBA4DA8E1 7E8BEA4A77E945BBE981E49569DB55B598A3821F56B154A0E9D5E0B9A79465EE75E919516DA8E5 111789AE3A6D8DD57DAE36638DA9DE59248989BBEC896E96B45A5E6D3B1F94E577BADB8DF63926 B268D886125496E75E614992B1A8E98A055681374E14A8BA36D46C5624E07ED4ADB5F8E7A80552 157ED940C77DA6A1EDA829E65ACDBD6D96568809D7798F67C977932745D75EF5F8E365166795F8 5A13980498066FBBF8388D865829B74D96E81A917ADF4D4B4F5A5FB629AF54F5ABAC98E0D17E18 D069D3694DD5D6F77B42ED2925334A6E35BD14205E4496BABED4ACB638167A065D99DB5748E952 86F9AF919AE4C8255786397BF6EB6EB619E259F59F96FA669A496C9179557A076C8D952C75DA6B 8E5B2BA608D7EDD528AED5E6FA9DDFA56BAE6E9916EA5A8E6897D67EBAE355DA5192D864E9F99F B9958D7AF98E61A7C67DB6E74DB4752B4244AC654E5588552B8E34E1AE041E6926D35255492B16 79AB205624998218D1749A52F5AB49893528BA095D859B12665958629A799DF9496606A18DE368 4A5BA34596DE46D8B97D365F49229DEEDA5F4A266C6591A1816815A606079826DE66296295DAE9 616C9F8D97ACEED56004D45166562299EEE95922AD7E2BE9BAE75F979A49B624A12594A119D6AC D9AE6376B85396595362E961811A5FB6395266D899D926E15EB4DDF61AEE96069262D6D616EBD1 66D899AD16609767A949D8D249D76CA52A6745B895B9281149A865AC5C5E621561DA056D362863 EDFB9F41F4D6C65D66079EE7EBEBB2A7A096EBE185A8E5A698E9D894E4B966E586755E89A0293A 484DA758AD8537DEBE68E156999F96E76D51DA7DB9F7637A16949587A6A45539536B798EDB4995 626516E86146357DB9E81EB82779BE266F5236EB5A9854B769E5AE349159746835167E9A76761B EE75846F9A949A5E949DAE5B2E7E6763463A967EAB5A9EF6AD8E77DE6D486B69F6D98D2B658A37 9EB92DAF65F6ABA9FA53EAEBD7F6F77B42CBA1B9E03668DE4EBB758E0752759B2D895A1AB585A5 146BDF45BA21592A2D22581E7788563926D28D376A4469E37857E116889A8D97EDA6DBEC975AE1 BAE4A58519299DB616653B6E4ACB5349875215981AB6D76D1E5AE686FAD1BED8E145266A82DD6C 85D76C6134D825D8DEB621DA239BECBE05E36A3B6681DB5DA6D552B657464595E961F7539D496B 4A3612616A227AB819B68B499E0B126FA876652499B2B4A1829E1F94B96A94992149989E9664A0 5AB95F85D41935485BA926AD1692257E3B109DE0BAEEC4D265592E14B58E08E54988B58E18E9F4 A8E74F6D51D45A9B5B23BB28236524AC8D1F6D55D98E266DBA3E7695662966D79DB6B8E97EF899 79389E2F57E27926DF4E346A96AB25266B93592469E5874E6A5F5DAE6B22527591F6AB6D4AFA9F 7DF4E3875BDDED0B3F8924325062A344A581D76EB13AA381E9E96AB697579A51749B608868D2B9 D8EC561BA769AE5DE6941E2E2FD699E7E98EF4E5E9E8CF5D1151D7F5BD47D6D6D6AC763463B769 EAB6379FB9B7E9816AD9A5D49B6A06ABD98E9EAD286E519A9216A7DAD53BA1BD4B1DADD6D84D3F 7D9BE9DDB5B98D6BA1ADD05776AB209E651E74E95969556382D8A1ADF97E23B6EB9DF8605A0DE5 99D95F8E885DAD569D49F9ADBE17D16D1AE5D7C649D79FB465867B99B1A5F9AEB5F7ADADA49651 9D6B529ADB5697DFA617694E5C5D7DBDDED0BB4953240E84B8C9D1B6400991FB5A77AB5AB4099D A698EF77D4BD9A07DD6615DD9AA51D550B6CAAC6DA7E5FD197F7D5A53B2CB558DE6AA76396CADD A52A419EC86509E82DB45AABBE5ADFB2D5A18D1BE5BE7B57491A6D8EC956850875B62B63B60952 76397AAE5B4AA6352385DF6AB85F6B5298207DD8DE7525633941A6F62367665B6C9A561681452D 82F6AB46DAEC79845DFE9B1D75F81375EA5DF429D368D16D8BD5979AC75D4A1AEE8799D579A894 A69E97794C5FB619A949FB27B2A91676C79F89E2119E6B9F19B36B417B41D7E3B6E0965D29AEBA 075097975B6A28DA56B45F818BE387D491F63476AADA21861A8DBAB62E492B33614755FA582C4D 368D361CADDE9CD25415B859E422B6946F76C85AB68B7E4536A79AC850425ED1B62CAF91B75982 20A56BD6719A186A36A48509AD884B1F92A9148BD5F71CABD98A6A0194CD3DF5FFE2F39A8BBDBD D5E3423967F5677DAABA5D06CD941457B99D1D6D8EAEA3B6A36075045015DB6689F9AC828D825D F89F76DA93961965AE946C755BAD182DDF81A21BFB54EF99A84D82A01DFD247D7466AB8B6565B2 BBBF8D4A01B3E5BB475313F598DD63EBE055FBDFCAD7414594B84B6B73B7D7EB4FE81C7751FAFF B56C45EA1BC5ED0A53EDA41FDDD935167A71A48D5B137D73D2FBADB14907774885D61115903A4A D0D570E140DD59C7A70645B4D6B4EA692AC1E1B45BC3A405BADBADDBDDF90A33C56DE774A4745A BDAD39DD577492C5067D61209A87DDBCDBED56D9EFD89745D6F628B2D90B6B27B5BB986E5399ED A6F8E5D6E7498EE6791E6BBD90BE8565E65AA5A6E24925526E9893A698D217F4E4A47B75ABB2D6 186066950A39FA6F50B769499B8979DA5575D96E82375E52BBA78258EE7D8863871E6C9AD4E34B 5D75F8E5C8974985936943E765B2CA62F6CBECB6B8E9F6D52662C96476A765B6D6AD7AF75D8E0B 5E7D07924D89A09DD499A1F45EB61BE58DD4ED35776F69FE475DB6D92692E78DD64B6DA7DA6EB1 D8D47DBA69F6F6654988A2C98A50A7D85D8E46D27DDA62B45A52B25B6551175182F7D176D4ED27 652656260669BE694D5DE16EA6C96F9ED8266E69562565AB9AA819766889499266F5FB655AC8A1 429D67779A1D4917ED75EA5F86676746B7A9825E635299A6B277E27A59EB7FF7A6B1D15B9ACB6C AEC58A6E057D26A191BDD8529924DE6A64A37544A07A15DD8EE99A865823B9245AB166E59D805D 39B4D1A7F92E499861885B9289205E7A9AEC7D5B635A92147E366DA93B67AED425F9FB697A39E9 4ED895B1FA6349D829FD94E046977D69B95184D759BA64927E985E7DE4DF66B7E5B5317BDDD5F9 BEEBBDE1538745C965684A2BAF95A1A6CB4B8E9F29B628E68E367DA63A758EE955B6B965DB69AC 746BE9E5E4E07605DAAED9ED74E45379D9AA425DA375DA526528726AD7E94967966DD76CB9F67D 8D1E53D7FBD5F774BE1A63865F6DA1292185A26576068976BB69BB181E76C7ECAAFB2B8E622B6E 5D50ADDEAD86AB9B9534AE9618E566E0677DF99D5A28667A616976885F97D2529634D1BE6A16A6 387F95F598D584897E362C85BBA545F7EB66E4AF7EC86087F45144D5F5481D84965DB5E3606B86 817BDA910677D1E6FA71B4D88BB69B549DE5B9D626798E1F4907989E65FB5AEA34A9262FB68EF4 E9F8D5F48B8BE94B97E2A796E6E9846DB6DB29357B2F52DA63B763AB4A5AE1A624D1DAD8769935 3D7809D3B4A554A48AD9E59445A98937AD53B7614A196976CDA5259845FAD3E9AB59234AF9D3A7 792D5259DDB7D4E18E5B65BEDB657E35BB60DAE5F637AD9528936554F96E52610825F983949F49 6BEBB53577457DEF77B42DD267E80788224587E6D6F8E4895926264A7815FB678D2763A7FBEF75 A9166E9BDA81E65F97DE60ADEB61B298EF8E57E5F62816E61763BEDD8D66782C8998AF6127DE66 E4A0469E5B7815FBB39520791B5ABEDA6387F654A6B86C6DA9E082DD6D52E8E68127DA25F99FB6 4B5F8606598537758938E34EDF66A19B5F892754BEE89246D9E197FB237DD4AF959B248DF9E482 DAC9F4B92881E58563A4A581BBDE8E56B825F9487D845F86EBE9C5F9AD3E759F8A7A53B759D6F7 7B42DF294CA8E19AC7567456DD4EDF614A159246D966E6F8678D1FEEB65B234D9EDD7749A1EA04 6FA54AE0AD619D589829F497496ABB60AEE85ED62D6D98176C9D36F8F5DD2CA6C96E1A5317B668 50B2676196C9D36AD7E60516D26DDA54BE0D6E62E405F95BDE82B7B5FE94D9D0D7F6B77B42DF8A 40BA8E22A8F815D1B42652558366E7C536BF53E9E74D5FB6AD15ED9BD5D1961BBBF51676D1BAD5 6460E6AF8F5D634E98B85ED6D167568BD335D52B5873B7BAA6E6397BA5B5638939E75AF8415FAA 7D6ED663351FEF459151DEF289945F560F7496AE74B9A7163BFEFB8F4477268DBDBDDED0B5B6B7 9EFBBADDC67274DB5BDDED0BA3425AF4F797A77B99D676C59E9DEAC747635EE17A1DEE7BEE1745 B34053DAF77B42D798D67BE2FF8379896B6FD7D69B8753C8454F56F77B42560FE03E540B64AFA9 2AE4AAAE5712AAD712AAB9712A4AAB94AEAB15985AAB1EAC7AAB16ACA4A92BAAB16ACEAC4559CA AEAACE4AAB292A4AB9292ABCA92B28ABB92ABB292A47A912AE5886AB921AAE28B8ABA03A9DE17A 933BABB6AACE52B154AAACE5755655F7616AEB0'H } , annot { { desc { name "Table1" } , data ftable { { data gene { locus "1" , locus-tag "SEA_PENNY1_1" } , location int { from 525 , to 818 , strand plus , id local str "Penny1" } } , { data gene { locus "2" , locus-tag "SEA_PENNY1_2" } , location int { from 855 , to 1274 , strand plus , id local str "Penny1" } } , { data gene { locus "3" , locus-tag "SEA_PENNY1_3" } , location int { from 1360 , to 1680 , strand plus , id local str "Penny1" } } , { data gene { locus "4" , locus-tag "SEA_PENNY1_4" } , location int { from 1680 , to 2624 , strand plus , id local str "Penny1" } } , { data gene { locus "5" , locus-tag "SEA_PENNY1_5" } , location int { from 2628 , to 3263 , strand plus , id local str "Penny1" } } , { data gene { locus "6" , locus-tag "SEA_PENNY1_6" } , location int { from 3290 , to 3799 , strand plus , id local str "Penny1" } } , { data gene { locus "7" , locus-tag "SEA_PENNY1_7" } , location int { from 3837 , to 3912 , strand plus , id local str "Penny1" } } , { data rna { type tRNA } , comment "Hypothetical Protein" , location int { from 3837 , to 3912 , strand plus , id local str "Penny1" } } , { data gene { locus "8" , locus-tag "SEA_PENNY1_8" } , location int { from 3953 , to 4027 , strand plus , id local str "Penny1" } } , { data rna { type tRNA } , comment "Hypothetical Protein" , location int { from 3953 , to 4027 , strand plus , id local str "Penny1" } } , { data gene { locus "9" , locus-tag "SEA_PENNY1_9" } , location int { from 4062 , to 4136 , strand plus , id local str "Penny1" } } , { data rna { type tRNA } , comment "Hypothetical Protein" , location int { from 4062 , to 4136 , strand plus , id local str "Penny1" } } , { data gene { locus "10" , locus-tag "SEA_PENNY1_10" } , location int { from 4166 , to 4420 , strand plus , id local str "Penny1" } } , { data gene { locus "11" , locus-tag "SEA_PENNY1_11" } , location int { from 4417 , to 5961 , strand plus , id local str "Penny1" } } , { data gene { locus "12" , locus-tag "SEA_PENNY1_12" } , location int { from 5961 , to 6926 , strand plus , id local str "Penny1" } } , { data gene { locus "13" , locus-tag "SEA_PENNY1_13" } , location int { from 6956 , to 8656 , strand plus , id local str "Penny1" } } , { data gene { locus "14" , locus-tag "SEA_PENNY1_14" } , location int { from 8653 , to 10107 , strand plus , id local str "Penny1" } } , { data gene { locus "15" , locus-tag "SEA_PENNY1_15" } , location int { from 10104 , to 10943 , strand plus , id local str "Penny1" } } , { data gene { locus "16" , locus-tag "SEA_PENNY1_16" } , location int { from 10981 , to 11505 , strand plus , id local str "Penny1" } } , { data gene { locus "17" , locus-tag "SEA_PENNY1_17" } , location int { from 11538 , to 12530 , strand plus , id local str "Penny1" } } , { data gene { locus "18" , locus-tag "SEA_PENNY1_18" } , location int { from 12601 , to 12786 , strand plus , id local str "Penny1" } } , { data gene { locus "19" , locus-tag "SEA_PENNY1_19" } , location int { from 12795 , to 13166 , strand plus , id local str "Penny1" } } , { data gene { locus "20" , locus-tag "SEA_PENNY1_20" } , location int { from 13163 , to 13297 , strand plus , id local str "Penny1" } } , { data gene { locus "21" , locus-tag "SEA_PENNY1_21" } , location int { from 13294 , to 13662 , strand plus , id local str "Penny1" } } , { data gene { locus "22" , locus-tag "SEA_PENNY1_22" } , location int { from 13664 , to 14023 , strand plus , id local str "Penny1" } } , { data gene { locus "23" , locus-tag "SEA_PENNY1_23" } , location int { from 14034 , to 14441 , strand plus , id local str "Penny1" } } , { data gene { locus "24" , locus-tag "SEA_PENNY1_24" } , location int { from 14472 , to 15068 , strand plus , id local str "Penny1" } } , { data gene { locus "25" , locus-tag "SEA_PENNY1_25" } , location int { from 15119 , to 15580 , strand plus , id local str "Penny1" } } , { data gene { locus "26" , locus-tag "SEA_PENNY1_26" } , location int { from 15119 , to 15978 , strand plus , id local str "Penny1" } } , { data gene { locus "27" , locus-tag "SEA_PENNY1_27" } , location int { from 15978 , to 19004 , strand plus , id local str "Penny1" } } , { data gene { locus "28" , locus-tag "SEA_PENNY1_28" } , location int { from 19011 , to 20381 , strand plus , id local str "Penny1" } } , { data gene { locus "29" , locus-tag "SEA_PENNY1_29" } , location int { from 20378 , to 22174 , strand plus , id local str "Penny1" } } , { data gene { locus "30" , locus-tag "SEA_PENNY1_30" } , location int { from 22197 , to 22640 , strand plus , id local str "Penny1" } } , { data gene { locus "31" , locus-tag "SEA_PENNY1_31" } , location int { from 22651 , to 22965 , strand plus , id local str "Penny1" } } , { data gene { locus "32" , locus-tag "SEA_PENNY1_32" } , location int { from 22962 , to 23264 , strand plus , id local str "Penny1" } } , { data gene { locus "33" , locus-tag "SEA_PENNY1_33" } , location int { from 23276 , to 25033 , strand plus , id local str "Penny1" } } , { data gene { locus "34" , locus-tag "SEA_PENNY1_34" } , location int { from 25033 , to 25320 , strand plus , id local str "Penny1" } } , { data gene { locus "35" , locus-tag "SEA_PENNY1_35" } , location int { from 25381 , to 25647 , strand minus , id local str "Penny1" } } , { data gene { locus "36" , locus-tag "SEA_PENNY1_36" } , location int { from 25644 , to 26789 , strand minus , id local str "Penny1" } } , { data gene { locus "37" , locus-tag "SEA_PENNY1_37" } , location int { from 27199 , to 27630 , strand plus , id local str "Penny1" } } , { data gene { locus "38" , locus-tag "SEA_PENNY1_38" } , location int { from 27721 , to 27903 , strand minus , id local str "Penny1" } } , { data gene { locus "39" , locus-tag "SEA_PENNY1_39" } , location int { from 27919 , to 28047 , strand minus , id local str "Penny1" } } , { data gene { locus "40" , locus-tag "SEA_PENNY1_40" } , location int { from 28048 , to 28191 , strand minus , id local str "Penny1" } } , { data gene { locus "41" , locus-tag "SEA_PENNY1_41" } , location int { from 28192 , to 28575 , strand minus , id local str "Penny1" } } , { data gene { locus "43" , locus-tag "SEA_PENNY1_43" } , location int { from 28698 , to 28868 , strand minus , id local str "Penny1" } } , { data gene { locus "44" , locus-tag "SEA_PENNY1_44" } , location int { from 28865 , to 29104 , strand minus , id local str "Penny1" } } , { data gene { locus "45" , locus-tag "SEA_PENNY1_45" } , location int { from 29097 , to 29462 , strand minus , id local str "Penny1" } } , { data gene { locus "46" , locus-tag "SEA_PENNY1_46" } , location int { from 29449 , to 29634 , strand minus , id local str "Penny1" } } , { data gene { locus "47" , locus-tag "SEA_PENNY1_47" } , location int { from 29634 , to 29828 , strand minus , id local str "Penny1" } } , { data gene { locus "48" , locus-tag "SEA_PENNY1_48" } , location int { from 29828 , to 30010 , strand minus , id local str "Penny1" } } , { data gene { locus "49" , locus-tag "SEA_PENNY1_49" } , location int { from 30041 , to 31855 , strand minus , id local str "Penny1" } } , { data gene { locus "50" , locus-tag "SEA_PENNY1_50" } , location int { from 31866 , to 32054 , strand minus , id local str "Penny1" } } , { data gene { locus "51" , locus-tag "SEA_PENNY1_51" } , location int { from 32063 , to 32311 , strand minus , id local str "Penny1" } } , { data gene { locus "52" , locus-tag "SEA_PENNY1_52" } , location int { from 32304 , to 32492 , strand minus , id local str "Penny1" } } , { data gene { locus "53" , locus-tag "SEA_PENNY1_53" } , location int { from 32502 , to 33209 , strand minus , id local str "Penny1" } } , { data gene { locus "54" , locus-tag "SEA_PENNY1_54" } , location int { from 33269 , to 33859 , strand minus , id local str "Penny1" } } , { data gene { locus "55" , locus-tag "SEA_PENNY1_55" } , location int { from 33891 , to 35909 , strand minus , id local str "Penny1" } } , { data gene { locus "56" , locus-tag "SEA_PENNY1_56" } , location int { from 35906 , to 36112 , strand minus , id local str "Penny1" } } , { data gene { locus "57" , locus-tag "SEA_PENNY1_57" } , location int { from 36102 , to 36215 , strand minus , id local str "Penny1" } } , { data gene { locus "58" , locus-tag "SEA_PENNY1_58" } , location int { from 36212 , to 36934 , strand minus , id local str "Penny1" } } , { data gene { locus "59" , locus-tag "SEA_PENNY1_59" } , location int { from 36938 , to 37705 , strand minus , id local str "Penny1" } } , { data gene { locus "60" , locus-tag "SEA_PENNY1_60" } , location int { from 37702 , to 37995 , strand minus , id local str "Penny1" } } , { data gene { locus "61" , locus-tag "SEA_PENNY1_61" } , location int { from 37992 , to 38156 , strand minus , id local str "Penny1" } } , { data gene { locus "62" , locus-tag "SEA_PENNY1_62" } , location int { from 38153 , to 38245 , strand minus , id local str "Penny1" } } , { data gene { locus "63" , locus-tag "SEA_PENNY1_63" } , location int { from 38242 , to 38901 , strand minus , id local str "Penny1" } } , { data gene { locus "65" , locus-tag "SEA_PENNY1_65" } , location int { from 39148 , to 39624 , strand minus , id local str "Penny1" } } , { data gene { locus "66" , locus-tag "SEA_PENNY1_66" } , location int { from 39706 , to 40530 , strand minus , id local str "Penny1" } } , { data gene { locus "67" , locus-tag "SEA_PENNY1_67" } , location int { from 40527 , to 40946 , strand minus , id local str "Penny1" } } , { data gene { locus "68" , locus-tag "SEA_PENNY1_68" } , location int { from 40943 , to 41173 , strand minus , id local str "Penny1" } } , { data gene { locus "69" , locus-tag "SEA_PENNY1_69" } , location int { from 41197 , to 42006 , strand minus , id local str "Penny1" } } , { data gene { locus "70" , locus-tag "SEA_PENNY1_70" } , location int { from 42006 , to 42080 , strand minus , id local str "Penny1" } } , { data gene { locus "71" , locus-tag "SEA_PENNY1_71" } , location int { from 42077 , to 42139 , strand minus , id local str "Penny1" } } , { data gene { locus "72" , locus-tag "SEA_PENNY1_72" } , location int { from 42136 , to 42444 , strand minus , id local str "Penny1" } } , { data gene { locus "73" , locus-tag "SEA_PENNY1_73" } , location int { from 42441 , to 42635 , strand minus , id local str "Penny1" } } , { data gene { locus "74" , locus-tag "SEA_PENNY1_74" } , location int { from 42632 , to 42844 , strand minus , id local str "Penny1" } } , { data gene { locus "75" , locus-tag "SEA_PENNY1_75" } , location int { from 42844 , to 43071 , strand minus , id local str "Penny1" } } , { data gene { locus "76" , locus-tag "SEA_PENNY1_76" } , location int { from 43068 , to 43208 , strand minus , id local str "Penny1" } } , { data gene { locus "77" , locus-tag "SEA_PENNY1_77" } , location int { from 43237 , to 44052 , strand minus , id local str "Penny1" } } , { data gene { locus "78" , locus-tag "SEA_PENNY1_78" } , location int { from 44049 , to 44483 , strand minus , id local str "Penny1" } } , { data gene { locus "79" , locus-tag "SEA_PENNY1_79" } , location int { from 44499 , to 45008 , strand minus , id local str "Penny1" } } , { data gene { locus "80" , locus-tag "SEA_PENNY1_80" } , location int { from 45367 , to 45630 , strand minus , id local str "Penny1" } } , { data gene { locus "81" , locus-tag "SEA_PENNY1_81" } , location int { from 45627 , to 45806 , strand minus , id local str "Penny1" } } , { data gene { locus "82" , locus-tag "SEA_PENNY1_82" } , location int { from 45809 , to 46042 , strand minus , id local str "Penny1" } } , { data gene { locus "83" , locus-tag "SEA_PENNY1_83" } , location int { from 46044 , to 46274 , strand minus , id local str "Penny1" } } , { data gene { locus "84" , locus-tag "SEA_PENNY1_84" } , location int { from 46276 , to 47043 , strand minus , id local str "Penny1" } } , { data gene { locus "85" , locus-tag "SEA_PENNY1_85" } , location int { from 47140 , to 47385 , strand minus , id local str "Penny1" } } , { data gene { locus "86" , locus-tag "SEA_PENNY1_86" } , location int { from 47403 , to 47786 , strand minus , id local str "Penny1" } } , { data gene { locus "87" , locus-tag "SEA_PENNY1_87" } , location int { from 47783 , to 47998 , strand minus , id local str "Penny1" } } , { data gene { locus "88" , locus-tag "SEA_PENNY1_88" } , location int { from 48011 , to 48169 , strand minus , id local str "Penny1" } } , { data gene { locus "89" , locus-tag "SEA_PENNY1_89" } , location int { from 48171 , to 48479 , strand minus , id local str "Penny1" } } , { data gene { locus "90" , locus-tag "SEA_PENNY1_90" } , location int { from 48510 , to 49229 , strand minus , id local str "Penny1" } } , { data gene { locus "91" , locus-tag "SEA_PENNY1_91" } , location int { from 49256 , to 49372 , strand minus , id local str "Penny1" } } , { data gene { locus "92" , locus-tag "SEA_PENNY1_92" } , location int { from 49385 , to 49507 , strand minus , id local str "Penny1" } } , { data gene { locus "93" , locus-tag "SEA_PENNY1_93" } , location int { from 49520 , to 49678 , strand minus , id local str "Penny1" } } , { data gene { locus "64" , locus-tag "SEA_PENNY1_64" } , location int { from 38717 , to 39124 , strand minus , id local str "Penny1" } } , { data gene { locus "42" , locus-tag "SEA_PENNY1_42" } , location int { from 28572 , to 28697 , strand minus , id local str "Penny1" } } } } } } , seq { id { local str "Penny1_1" } , descr { title "HNH endonuclease [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 97 , seq-data ncbieaa "MSWSTSDRSTRLPDDWPAIRRQVLRDAGWICEIGWSGCLLEATEVDHIRRGDD HSRANLRAACSSCHGKKSSAEGNARKRQLRARRKRPTERHPGRI" } , annot { { data ftable { { data prot { name { "HNH endonuclease" } } , location int { from 0 , to 96 , id local str "Penny1_1" } } } } } } , seq { id { local str "Penny1_2" } , descr { title "Minor tail protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 139 , seq-data ncbieaa "MGERGPVRKRSDQRVRRNKDAVPTEKVTAIGTVPIPELGFDDPHPIVRDLYRS LTESAQRRYYEPSDWQYARTALHFLDGLLKSPKPNGQLLTTVNSMLSSLLVSEGDRRRVQLEIERKEAEGVVVDVAQI FRDRLAQG" } , annot { { data ftable { { data prot { name { "Minor tail protein" } } , location int { from 0 , to 138 , id local str "Penny1_2" } } } } } } , seq { id { local str "Penny1_3" } , descr { title "minor tail protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 106 , seq-data ncbieaa "MADIGTRLDSDSLVLWRGRDFKWTFENLDASGEPVNFPAGTLYFELQTSPKTE WEFDIVGAVATIKVESTDADAIPDRTKWQLVFLPDGEASGGDPLAWGTVSKVG" } , annot { { data ftable { { data prot { name { "minor tail protein" } } , location int { from 0 , to 105 , id local str "Penny1_3" } } } } } } , seq { id { local str "Penny1_4" } , descr { title "minor tail protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 314 , seq-data ncbieaa "MRLRGFPTDGKSALSYVGTPTGKIVGSRPAFSLISVPTEAPKGVLTRVRPSGR LLGLPGPIGPQGPAGEGLHIDGQVADYDDLPASVPDGEIWIAGGLLYRYDGGWPPEADGAPVQGVEGPQGLTGPQGPT GPQGPQGPQGPRGFTGDTGPQGEQGPTGPQGPKGDTGSQGPQGPKGDTGPAGPTGPTGDQGPQGDQGIQGIQGPQGPS GPKGDKGDKGDTGNPGPTGPQGDTGPEGPQGDPGPQGPKGDTGDTGPQGPKGDTGAQGPQGVQGPQGPAGVPSSNGTV LDFVKLTQAAYDALSPKVATTFYVIVG" } , annot { { data ftable { { data prot { name { "minor tail protein" } } , location int { from 0 , to 313 , id local str "Penny1_4" } } } } } } , seq { id { local str "Penny1_5" } , descr { title "Hypothetical Protein SEA_PENNY1_5 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 211 , seq-data ncbieaa "MAIRYGNVNPNAFRVGTQTPSRIFLGNDQVWPEFTSATQQYTTAGAFTYDIPA NCLYLDIIVLGSGACGKGMQFIDLWGPGGGAGQWNSVTLRRGVDIPWSVLTVTGTVGQGRPSNGQGASLAGNPTTATI TGYGSITGAGGVAGSSAGGGLEGKSPGNHVRNGITYVGGAAQGNIGGAGNPPGGGGASHTITFGSGGAGANGSVWVRA YI" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 210 , id local str "Penny1_5" } } } } } } , seq { id { local str "Penny1_6" } , descr { title "Hypothetical Protein SEA_PENNY1_6 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 169 , seq-data ncbieaa "MPNPTNTEDYEFAFCFEVKGQSVFGNADPDTFYPNIQYGYRGADGEPPAAIIQ AYLDNLWQADQDFLRISVLYVAPVTWTVIDPDDVGTLPGSIEDYSFGMMFDVVDNSVDPPFILEGYAMVGDGAYGAQY SQFLSFYEGKAAAPGSTVRNPRFVYAPKIAWSTWEFEA" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 168 , id local str "Penny1_6" } } } } } } , seq { id { local str "Penny1_7" } , descr { title "Hypothetical Protein SEA_PENNY1_10 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 84 , seq-data ncbieaa "MLATIAKLIAQALLPIIAKQIADEFGKHVEPLTKALVTAVTEAAATGAERGAD KLTDYIPGTLDDQIIDPIVKRGLEIFRGLTR" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 83 , id local str "Penny1_7" } } } } } } , seq { id { local str "Penny1_8" } , descr { title "Lysin A [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 514 , seq-data ncbieaa "MTEKVLPYDRSIVPQETGWWCGPAATQVVLNSRGIIVPEATLAAEIEAIENPG RGDDRDGTDYVGLIEQVLDRRVPAARYTSVYLTNDPPTQAQKDRLWEHIVRSINAGYGVVMNWVAPPSNKPRGVKGSV SPRYSGGTTYHYVACMGYDDTPGARAVWIADSGFQPQGYWISFDQCATLIPPKGYAYADAAPAAPAPAPTPVVDAAPI LARAAGISEAKAREILPTMRDGLKQADCTTVNRIAMFIAQTGHESDDFRATEEYANGPLDQERWIYKGRTWIQITWRE HYARFGKWCFDRGLVTDPDVFVKNPRALADLKWAGIGAAWYWTVERPDINVLCDRRDIETVSRRINGTNPNTGRANHI EERIARWNRALAVGDDLLQLIREEEDGFLSALTPAEQRALYNEIMKKGPTRSFMAEDQNQIETLLGFVYNIDGNIWND AVTRAYLFDVPLAVEYVERVARDGVHPKSWAFQQLDGKGERWLAKFGQEYCKGLIRFKKKLNDLLEPYGEN" } , annot { { data ftable { { data prot { name { "Lysin A" } } , location int { from 0 , to 513 , id local str "Penny1_8" } } } } } } , seq { id { local str "Penny1_9" } , descr { title "Lysin B [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 321 , seq-data ncbieaa "MPLRVGSNDANTGGLVSRWQKTMLARYAAYAKAYDGGPLRVDGYFGYDDADVQ REYERRTHQVVDGEVSDADLRALGLEAAKRWLFTVHGTGQADPLGPGLPADTARAVLDKYTWQPIGNYPARAFPMWSS IMDGARELRSQIASKSGEVNLAGYSQGAVVVGQVLKHDIMDPKGSLHHRLGDVRKVVLWGNPMRQRGIAHFDEWIHPV AGPDSYGILDDRLEGLEKAPFEIRDYAHAGDMYASITDGDKDEYKIAICKIVMTATDFYRGPNSVVSQLIELGQRPLT EGIAMALAIIDTLRFFTNTAHGYNIGPAIDFLRS" } , annot { { data ftable { { data prot { name { "Lysin B" } } , location int { from 0 , to 320 , id local str "Penny1_9" } } } } } } , seq { id { local str "Penny1_10" } , descr { title "Terminase [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 566 , seq-data ncbieaa "MSLDNHHPELAPSPPHVIGPTWARTVDGGWYLPEKTLGWGVLNWWAAYVKTPG GEHAGSPFMPTLEQARFTLWWYAVDDNGNYVYREGILRRLKGWGKDPFAAALSLAELCGPVAFSHFDADGNPVGKPRH AAWITIAAVSQDQTKNTFSLFPIMISKQLKEDYGLLVNRFIIYSEAGGRIEAATSSPASVEGNRPTFVIENETQWWGA GPGGEINDGHAMHGAIEGNLTKIPGARRLAICNAHIPGNDTVAEKDWDAYQDILSGKAVDTGMLYDALEAPADTPVSE IPSQREDPEGYQLGIKKLREGIEIARGDSYWLPVDEILMSILDIKNSITESRRKFLNQINAHEDSWISPNEWNRCQPS TIQPLTKGDRITLGFDGSKSNDWTALVACRVDDGMLFLIKVWNPEDYESGEVPREDVDATVRSMFASYDVVAFRADVK EFEAYVDQWGRDFRKKIQVNATPGNPIAFDMRGQTKRFAFDCERFLDAVIEQEVFHDGNPVLKQHVCNARRHPTTYDA IAIRKASKDSGKKIDAAVCAVLAFGARQDFLMSKRNRTRRAVMIK" } , annot { { data ftable { { data prot { name { "Terminase" } } , location int { from 0 , to 565 , id local str "Penny1_10" } } } } } } , seq { id { local str "Penny1_11" } , descr { title "Portal protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 484 , seq-data ncbieaa "MTSPLQKQENVDPEKAREEMLNLFTERTQDLGDNTAYYESERRPDAVGVTVPQ QMQKLLAHVGYPRLYIDAIAARQELEGFRLGGADKADEQLWDWWQANDLDIESTLGHTDSLVHGRSYITISKPDPNID PGVDPEVPIIRVEPPTNLYAQIDPRTRQVMRAIRAIEDEEGNEVIGATLYLPNNTVIWNREDGQWVQVANVAHNLEMV PVIPIPNRTRLSDLYGTTEITPELRSVTDAAARTLMLMQATAELMGVPQRLLFGVKGEELGVDPETGQTLFDAYLARI LAFEDHESKAQQFSAAELRNFVDALDALDRKAAAYTGLPPYYLSFSSENPASAEAIRSSESRLVKTVERKNKIFGGAW EQAMRVAYKVMNGGDIPPEYYRMESIWRDPSTPTYAAKADAATKLYNNGQGVIPKERARIDMGYSITEREEMRKWDEE EQAQGLGLMGTMFGTDPSGGGNPDNPETPEPQPNPAEEAAA" } , annot { { data ftable { { data prot { name { "Portal protein" } } , location int { from 0 , to 483 , id local str "Penny1_11" } } } } } } , seq { id { local str "Penny1_12" } , descr { title "Capsid maturation protease [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 279 , seq-data ncbieaa "MTLEEYAAQQAVISSALANYVMRWAKFFANPALSVAEWLRFLELLWPEVQRRY EESAALARTFYDAQRALHHPELDPNERLLSELRFEWFVQNMEPARVKFSQEEAGDAGVAQVALRAVREVEMAGRRQII GAVKDDPAPRIIRGWARVATGRETCAWCLMLISRGPVYLGATNAGLDLDDDSAAEMIAAGEDVSEYMEQWHAGCDCKV VPVFKVDDWPGLEAQKRALRLWIDAGREASRLIESGKARTNNMNKETQNALRRRLERGEVRMSEFAAAAA" } , annot { { data ftable { { data prot { name { "Capsid maturation protease" } } , location int { from 0 , to 278 , id local str "Penny1_12" } } } } } } , seq { id { local str "Penny1_13" } , descr { title "Scaffolding protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 174 , seq-data ncbieaa "MPRRQSNMSDTPTTTDTPAATDQGQEPKVETFSREYVEGLRSEAARYRNEKKD AVEEAKTATRAEVVKEYEPQIAEKDSRISELETDLSARDLELLKIKAVLNAEIPSEDVLDVVTLIQGTDDDTVSESVK RVKALLGKAPAKSPAFDPTQGSGSHLPLNGNPLLDALKRAVGA" } , annot { { data ftable { { data prot { name { "Scaffolding protein" } } , location int { from 0 , to 173 , id local str "Penny1_13" } } } } } } , seq { id { local str "Penny1_14" } , descr { title "Major capsid protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 330 , seq-data ncbieaa "MAGSTVPSTQVALTGDFSAFLTPEQSQDYFAEIEKTSIVQRIARKVPMGPTGI SIPHWTGAVSASWTGEAERKPITKGSFGKQELEPVKITTIFAESAEVVRLNPLNYLNTMRTKIAEAIALKFDAAAIHG IDKPSAFKGYLAETTKVVSLADTNLTTASGPQGNAYLAVNNALSLLVNSGKKWTGTLLDNVTEPILNTAVDGNGRPLF VESTYTEQVGAIREGRILGRPTYVADNVVNGTVGNRVVGVMGDFSQVIWGQIGGLSFDVTDQATLDFGEEQGGVWVPK LISLWQHNMVAVRCEAEFAFMVNDKDAFVKLTDQVAGTDPEEE" } , annot { { data ftable { { data prot { name { "Major capsid protein" } } , location int { from 0 , to 329 , id local str "Penny1_14" } } } } } } , seq { id { local str "Penny1_15" } , descr { title "head-to-tail connector protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 61 , seq-data ncbieaa "MKIRHRANGGFATVDDETAEKLIALGIWERADAPKPASPKRSPRRRQRAAQKP AEAPNNEE" } , annot { { data ftable { { data prot { name { "head-to-tail connector protein" } } , location int { from 0 , to 60 , id local str "Penny1_15" } } } } } } , seq { id { local str "Penny1_16" } , descr { title "head-to-tail connector protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 123 , seq-data ncbieaa "MPYATASDVTSRWARQPTDEETALINVRLADVERMIKRRIPDLATKVTDPDYL EDLKQVEADAVLRLVRNPEGYLSETDGNYTYMLRSDLASGKLEIFPEEWEILGYRRSRMTVIVPNPVMPT" } , annot { { data ftable { { data prot { name { "head-to-tail connector protein" } } , location int { from 0 , to 122 , id local str "Penny1_16" } } } } } } , seq { id { local str "Penny1_17" } , descr { title "head-to-tail connector protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 44 , seq-data ncbieaa "MSIVIGGKLIDASKCVEDEETGESEHHCVHDWRIHWGNVDRGAG" } , annot { { data ftable { { data prot { name { "head-to-tail connector protein" } } , location int { from 0 , to 43 , id local str "Penny1_17" } } } } } } , seq { id { local str "Penny1_18" } , descr { title "head-to-tail connector protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 122 , seq-data ncbieaa "MSLLDGGPAYEDVIVYPEEVVTDEDGNTQTRPSKTGIPAKARFQVQGQSGTSA RRAEQDNEGFESEKVYRMRFPRSWDAEHGVLGAQSEIEWRGVRWALFGDVNFYNSSRRTARIDYTVKRY" } , annot { { data ftable { { data prot { name { "head-to-tail connector protein" } } , location int { from 0 , to 121 , id local str "Penny1_18" } } } } } } , seq { id { local str "Penny1_19" } , descr { title "head-to-tail connector protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 119 , seq-data ncbieaa "MARLIGQKAMNHVISHLDGVKDAVYAEAKERGRKAEANLAQARASTRWHKIFG PDHLTRVTVTRGDVDSFINLEAPNAMAIEFGHQPSGVFGPGGMFGHLDTKAPEGLYIITSAAGLRG" } , annot { { data ftable { { data prot { name { "head-to-tail connector protein" } } , location int { from 0 , to 118 , id local str "Penny1_19" } } } } } } , seq { id { local str "Penny1_20" } , descr { title "head-to-tail connector protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 135 , seq-data ncbieaa "MAQMPRVQAVVLPILRAALPDVKVGSWIEDIDYRTFPMVNVRRVGGPRHETRP DKLALPVIEMTAYGREGLVETEKLYEDALEALYDAVKHQTQTPAGYLHSIKETMGATQFSSLFQDSWRVQGLIQLGVR PPRS" } , annot { { data ftable { { data prot { name { "head-to-tail connector protein" } } , location int { from 0 , to 134 , id local str "Penny1_20" } } } } } } , seq { id { local str "Penny1_21" } , descr { title "Major tail protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 198 , seq-data ncbieaa "MALNDDAVLTAAVGYVYTAPVGTAAPTPAQLKTLNLTDTGLWTPTGWDSIGHT SRGDMPEFGFDGGDTEVRGSWQKKKLREVTTEDPVDYLTLFLHQFDEQAFELYYGANASTTPGVFGVSAASGDPTEKA FLVVIVDGDERVGFHAHKASVRRDDAIQLPTDDFAALPVRATFLQHNNELLFSWINEDLFNVEEEEE" } , annot { { data ftable { { data prot { name { "Major tail protein" } } , location int { from 0 , to 197 , id local str "Penny1_21" } } } } } } , seq { id { local str "Penny1_22" } , descr { title "Tail assembly chaperone [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 153 , seq-data ncbieaa "MAGLPLPPSHIGPPNFHERSAMSNVFTLDSFREEADREFAPVKLELGGDDAVV LRNVLRIQKTRREEVFQLLEKLDSIAKDDEGKQREEDDLDASEMEAMGDIALRMIELVADNDALGSRLVDELRDDLAL TLKVFEAWMNATQPGEAERSPA" } , annot { { data ftable { { data prot { name { "Tail assembly chaperone" } } , location int { from 0 , to 152 , id local str "Penny1_22" } } } } } } , seq { id { local str "Penny1_23" } , descr { title "Tail assembly chaperone [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 286 , seq-data ncbieaa "MAGLPLPPSHIGPPNFHERSAMSNVFTLDSFREEADREFAPVKLELGGDDAVV LRNVLRIQKTRREEVFQLLEKLDSIAKDDEGKQREEDDLDASEMEAMGDIALRMIELVADNDALGSRLVDELRDDLAL TLKVFEAWMNATQPGGSRALARLIDEYGDCLVADLWETYGVDLRDIYLPESRLSPKLALVLIKELPVGSRFYAEKRGG KQFRGWDESRYALVAIVNAVRALQYTYVAAHSKSKPKPPDPFPTPQRTKARQIRKAGSFAWMAAKQIAAARKRKAQT" } , annot { { data ftable { { data prot { name { "Tail assembly chaperone" } } , location int { from 0 , to 285 , id local str "Penny1_23" } } } } } } , seq { id { local str "Penny1_24" } , descr { title "tape measure protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 1008 , seq-data ncbieaa "MSGGAGGQEVGRISVRVVPNTDHFRRQLKTQLEAIEKSMRGEVGIGANLNSKA ALAQFAAMMAAMRATAGRGVTVDVNTDRRAAQTLSLLRDGMKDWGRALNDGRLAVSNFRRELNQMTLAQQRERPLLNH TYAYLKSVNEMRRRGANYVREFTDALRTQQAWLRQQDKTLTANQARWKSWMMAIRDANVNATNGFRKFQQALRGMRSG GSGDGPGGLGSMSRLFSAFGDDAEKAGSQVEHVGKKFLGLTRMGWLVTGVFVAAAPAIGLVAGLLAGLPSLIGAFGAG VGAVALGMDGIKAAAEALMPAFEQMKTAVSGVFEQGLKPQFEQILAMMPMLTTGMQGVAQGMVSMFQGVTDALASGAG PAQLENILANTKMFFEQLQPAANQFTQSFLTLASSGSDAFGYLSGSLNTFATQFNEMVNRVSQNGVMDGAMKGLSQTL DGVTNLFTRLMESGLQAMGQLGGPLNNFLTGIGDLAVALMPALTSLSGLIGNVLGSLGTALAPIVTALTPAFTTLADT LGSLLVPNLQTLGNILTPVATMIGTTLTTALQQIQPMVPGLVENFAQLGNTLVTNLAPHIPALATAMGQMAGSVIKLA PMLISQLVPAFIDLIPSVTQLLPHVVSLAEAFARMMPAILPLVSIIFSLVAAFAQAAATIGGVVLGAISSLIGVISEV ITKVSEWVASFAQGASDIAAKAAELPGMVKSALGDLGSFLVESGKALIAGFARGIEAGIDLAVGAAQRVVGAVRNLFP FSPAKEGPFSGRGWVSYSGQSVGEAFADGMKSTQGSIVQTAKEIMQAAKEVFGDAANLAFNFNFGQMQSQMASLADTS QDLRKSMAGSVSGATSPNKIDAETRKEMDLLSVKKDELELERQRLQMEKNQTTDKAAKAALQQRIDELQMQKQQLELQ RQQMDYQAKYTDQVSATGSEYDDLLNKTARMPYDFARATTDQFLSDVGISGDGALSQALKEGLKFGEQFIFNVGSMDE AVQGQQTIQNKKALQFDRR" } , annot { { data ftable { { data prot { name { "tape measure protein" } } , location int { from 0 , to 1007 , id local str "Penny1_24" } } } } } } , seq { id { local str "Penny1_25" } , descr { title "minor tail protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 456 , seq-data ncbieaa "MDTVVELEGVNGEWFTLAGPNEGDRGVHLGTDVKGLFDPPVKVVYEEPGNYPG ARYLNHRILRRDITFGVEILNDAAIGPNSWLSRDSEWRKAWAFDRDCKLYVTTPDSGTRYLKLRLGESPEVSLYTDPR KGKIHRVVMVCIAGDPFWYEDDVTYTAVTQEDTTFDPNPLPWPWPKEELPTETLTITVDPEDGKGGLNPTDQPIWLKW ILPGSTEEPAEPYIPGIPWLGAPNSPATIWTVPDYSFTEAAQANRRIRMPGLIGGLRTCEVQQISLVGDPTGGTFVLK FKGDTTAAIARNATAATVKSRLEALPSIGAGNLTVSGGPTLLSPHQPWRVSFTGDDFAGLPQPLIQAVSSLTDSDGDP NTVPNVRVDRTTEGFTATPENAVVDTDPRVEQVSSENGSQLWARMNGVRFHNPVPPYTKSKTFEITVSGAVPGQMVVL RIPRAWTRPWGLE" } , annot { { data ftable { { data prot { name { "minor tail protein" } } , location int { from 0 , to 455 , id local str "Penny1_25" } } } } } } , seq { id { local str "Penny1_26" } , descr { title "Minor tail protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 598 , seq-data ncbieaa "MSHGTITTLEDANRVWNTVMAQRAMREAERLKPPLVRLWNGDMVLRGVVAGER GGDFEFIENDTGTASIQLSLDHHMAKWVMNFKGRDKRNVIITIDKQGARWSGFMDHYRVVREENGDCYLDVVFKHDYE QAKHILVWCNPFLRPELQFPKLWIIFGPAKWCLLLTLFVNILRLETSLWTLPDNPLDPTEWMPLSFNISNWRNIVKPF PLLGDNSNLTIVFSRFQSFHDVAKKTLQDAQLTIVCRRYLHGEDPHPFEDLRGELNIGPLEDLLSLIPIRHGCLVWDI IDNSGWGSETAFGGSWLTGFIRAVVNIASDGMTEGIDVFTGDPTFPGEYYTPWFLGTSPQAPWIVFEEGPYTGIKSSE FKYYEATDTSFVAGGESMPGVNEAISAAVNMGGDFLTSLINSAMASLGAVGGAIDLPPLGGMMDAVAKPLYENVFLAF QEYPTLRAVGMPLPIPLLETSETGLGDFHYYEGWVENATKAFTLSAFLATRAKIWETRAHTAHTIKVSDAAPYYVGEP GYGHFWLGSRVGTTVLGFPIPDTVFVERVSKIGYRWDKDGPKGWDLEIGYREPQDPVLKLFELIQRFNGAMGQLGIL" } , annot { { data ftable { { data prot { name { "Minor tail protein" } } , location int { from 0 , to 597 , id local str "Penny1_26" } } } } } } , seq { id { local str "Penny1_27" } , descr { title "Minor tail protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 147 , seq-data ncbieaa "MIKPQEEVDWKKPEEHFAWALRNMPTFAGVGAVTHPGFLQTWSKHLWECGFAH RDYLEQLADEDGNIHVSKLPKQQIRWQAPFRGARSTYNNAARWVSKDTPAPKPMRLPDVRQLTQQENEFMLRQYRELG LINDYIPQRDTAQELD" } , annot { { data ftable { { data prot { name { "Minor tail protein" } } , location int { from 0 , to 146 , id local str "Penny1_27" } } } } } } , seq { id { local str "Penny1_28" } , descr { title "Minor tail protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 104 , seq-data ncbieaa "MAATDDTQPLDLSELFDDDNDLGLNELVGISDEEVEAARKKVPEPALVRGGIM AVVGLVAFILGKQIDTTWVEPVMDVYVVAAPLALAWWIRRNVTPVGKHRAS" } , annot { { data ftable { { data prot { name { "Minor tail protein" } } , location int { from 0 , to 103 , id local str "Penny1_28" } } } } } } , seq { id { local str "Penny1_29" } , descr { title "Minor tail protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 100 , seq-data ncbieaa "MTPGFDPTDWVDLVAYAILTIPATIGAVAAWRSHQKVKQTHYEITNDHDSNIR HDIDDLAEAVREGFREIRKDIGGLREELRTERIERIEGDRLRVVNCK" } , annot { { data ftable { { data prot { name { "Minor tail protein" } } , location int { from 0 , to 99 , id local str "Penny1_29" } } } } } } , seq { id { local str "Penny1_30" } , descr { title "Minor tail protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 585 , seq-data ncbieaa "MTTPNPNPNNGPGAELEGWLGTGAFEIGGGAWNYGQDFTEAAVREMFELPAIT IFNALDLLEEQLLKMPLEALKVFEPLIPDVIEDDFADVASAVAKIIDTLTDGPAALLRGEFDEWLQDTFGALATEVHQ VLEILAGLAVTPINSTVQAVKDWWTQMTSGLGNAVTDLTKHINNTVNKFLGLTGTGHTAEDAAAAMGTIYNQVRTSAQ QLQDLMAEQTGAAHSGKSYVVSFSNMPNGPFPSEFDLTYSGTGTGYIAIQDGKAVWVKVADGDREVMGKYNDGDTLTD YQNISGTVANPMDNGAKNWVFGRCNAAKTSYVYAVGTRNSLLDFRAELGCVVGGVKYVFATNVPANPNFNLGVKIGTG KGLRNFQVISGNEVIIDYTDTAGISQVGANYRGWGFISSTSNGGNNVPAQAVLLTCSDADPSNATGSGAKISRLNVAN SGVSAGRHLFPANFYDSTDLATPDIIVDRTNGKFTASLAGWYRCEIGFRVNPNAFLSAWNCAPVIFKNGTVHRVGTDA YCFFYFGIGAGARYAQTSFSVYLDAGDYVQAGYDAGQAHGSLITGEAAGVETYFSISLLNRSLG" } , annot { { data ftable { { data prot { name { "Minor tail protein" } } , location int { from 0 , to 584 , id local str "Penny1_30" } } } } } } , seq { id { local str "Penny1_31" } , descr { title "Hypothetical Protein SEA_PENNY1_34 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 95 , seq-data ncbieaa "MQAVETTEAVIQAISKQLGEGVTDEQVANVLTALNNVKTGEPVGTIRREPATG KVAHRVEAFGVQQWRVSGPDGEQYNDLQPTLPEWALIFDPTA" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 94 , id local str "Penny1_31" } } } } } } , seq { id { local str "Penny1_32" } , descr { title "Hypothetical Protein SEA_PENNY1_35 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 88 , seq-data ncbieaa "MTQPQPQPGWYPDPSGAPGQRYFDGTEWTSHAQPPAHTPQPVAVMPKKTNHAL HLLLSILTFWLFGGWIWVWIFVAISNHNKTQTIYR" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 87 , id local str "Penny1_32" } } } } } } , seq { id { local str "Penny1_33" } , descr { title "Integrase, (Y-int) [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 381 , seq-data ncbieaa "MAPSRRSWGSLKTMRSGRIQASYVHPLDGVRYYALQTYDNRMDAEAWLNSERR LIEMETWTPPAERAKKKAASSITVEEYTKKWLTERGLAEGTRELYKTHARKRIYPVLGDTAVAEMTPALVRAWWAGMG HQHPTARRHAYNILRAVMNTAVEDKLLSENPCRIEQKAPNERDVEALTPQELETVAAEVHEHYRVAVYLLAWTSLRFG ELIEIRRKDIMDDGVTMKFRVRRGAARVGQKIVVGNTKTVRSKRPVTVPPHVAAMVREHMKDRKKMHKGPEALLLTTT QGERLSKSAFTRSLKKGYAKIGRTDLRVHDLRAVGATYAAQAGATTKELMVRLGHTTPRMAMKYQMASEARDEAIAEA MSKLASTTATQEGNAR" } , annot { { data ftable { { data prot { name { "Integrase, (Y-int)" } } , location int { from 0 , to 380 , id local str "Penny1_33" } } } } } } , seq { id { local str "Penny1_34" } , descr { title "Hypothetical Protein SEA_PENNY1_37 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 143 , seq-data ncbieaa "MRIVSRQRVALRVATTGTVAVGGLAFALSFTALSELAAANGVAQAWMVPLVVD GGIIVATAATVALTRHRWYAWTLLLLSSLVSVAGNVTHAQPHGAVAMVIAAIPPLWLLAATHLTVMLSRERSENEPVP VAAESLRIANAA" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 142 , id local str "Penny1_34" } } } } } } , seq { id { local str "Penny1_35" } , descr { title "HTH DNA binding domain protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 60 , seq-data ncbieaa "MELPLRASIQQVADHLGVSTRTVRNYIADGRLKAIRLGPRLIRVERSSVEELM RPIGNYA" } , annot { { data ftable { { data prot { name { "HTH DNA binding domain protein" } } , location int { from 0 , to 59 , id local str "Penny1_35" } } } } } } , seq { id { local str "Penny1_36" } , descr { title "Hypothetical Protein SEA_PENNY1_39 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 42 , seq-data ncbieaa "MKISGLILELQKALTNLGDLPLEDDIELLFSLQRGTLSVRIH" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 41 , id local str "Penny1_36" } } } } } } , seq { id { local str "Penny1_37" } , descr { title "Hypothetical Protein SEA_PENNY1_40 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 47 , seq-data ncbieaa "MHLVLYVLGFEVSIRARRREQPRPRVFVTEGGVLPVEDVAEILKEVI" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 46 , id local str "Penny1_37" } } } } } } , seq { id { local str "Penny1_38" } , descr { title "deoxycytidilate deaminase [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 127 , seq-data ncbieaa "MRPTWDEYFLEIAKTVAIRSDCERSRVGAVVVKDRRVRATGYNGAPAGRPGCS TCPRRTSGAIPGVSDYDSGVGRCVAVHAEANALLYCDREDLIGATLYITRAPCDGCRKLIDAAGIVNVIYPQEN" } , annot { { data ftable { { data prot { name { "deoxycytidilate deaminase" } } , location int { from 0 , to 126 , id local str "Penny1_38" } } } } } } , seq { id { local str "Penny1_39" } , descr { title "Hypothetical Protein SEA_PENNY1_43 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 56 , seq-data ncbieaa "MKEAIAGILLAVAMILGLTACDGETSTTNDDDDTYPHGIIYVPRVGTSPGIGP IFY" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 55 , id local str "Penny1_39" } } } } } } , seq { id { local str "Penny1_40" } , descr { title "Hypothetical Protein SEA_PENNY1_44 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 79 , seq-data ncbieaa "MAEPLLLIEKRDDGQYWVQWQGEDWGLLTCPQFDYRMDSYSTECEVSFRMIHR PKPAPKPKRTWSRAMGLRKPTRKEHP" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 78 , id local str "Penny1_40" } } } } } } , seq { id { local str "Penny1_41" } , descr { title "Hypothetical Protein SEA_PENNY1_45 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 121 , seq-data ncbieaa "MEDREFFDLLYQQWSKTTGAKDMFWMSEEYKDGTGRWKVYAVHVGTDHQETRK LIASELHSEADADFIAAVHGCLADLTRRLNSALDEADRADYDRDSRECRIAELELENAELRAKLEADG" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 120 , id local str "Penny1_41" } } } } } } , seq { id { local str "Penny1_42" } , descr { title "Hypothetical Protein SEA_PENNY1_46 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 61 , seq-data ncbieaa "MDEIPWSPAYRVTVADDDSRSFETNSAVVTIQTRVPQEVLADNVFRNVLAGIG KEITDGRS" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 60 , id local str "Penny1_42" } } } } } } , seq { id { local str "Penny1_43" } , descr { title "Hypothetical Protein SEA_PENNY1_47 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 64 , seq-data ncbieaa "MTDDNPIIAVLSKRLVQLDKEIRQGQTQVDFHARKQRELQGEIDKKDQEAQTI LDHLVALKQGV" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 63 , id local str "Penny1_43" } } } } } } , seq { id { local str "Penny1_44" } , descr { title "Hypothetical Protein SEA_PENNY1_48 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 60 , seq-data ncbieaa "MRTATAVFTAPHDATPEAIAYAEQQAIQELRRIGAFGEVYRERVEKHPEGLKF VYSAKEY" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 59 , id local str "Penny1_44" } } } } } } , seq { id { local str "Penny1_45" } , descr { title "DNA polymerase [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 604 , seq-data ncbieaa "MIEHRHEVAGTTVVIRVVENEDDLWGFRDFVRAHLGFLGLDTETTGLDIYSDG FRCRLVQFGTPNEAWVIPVELGPRYEEEARQALRNVKGFVLHNASYDLQVIERTLGIPMEDMWPKVTDTKILAHLVDP RPFKEGGIGHKLEELVKHYIDAPVAENVKTLMATLAREYKTTKAHIWTKVEWTNPYYQLYAGMDPILAARLLQKLIPL VPSVSQDLVPYEHKLAEICSYMERRGFLLDVEYSEKLSEDMLRKQDYWASKADILYGLENVNSPIQVAEALMRRGVKI TERTEGGQPKVDKVLLDRLIKEGDPLAEAISEAKKWGKWEKTWVRKFLDSRDSKDRCHASINPLQARTARMSITGIPA QTLPSGDWLVRRCFLADEGELMASVDYQAQELRVLAALSGDRTMIQAFRDGADLHLMTARAAWPDREITKDSPERKYA KTVNFGRVYGGGAKTVAEQTGLDMEAAKQVVDGFDRAYPGVQKLSRKLQMEASQKGHIVTPVGRRLPVDPSRAYSALN YLIQSSSRDVTGRALIRLHEAGFTRYLRLPIHDEILASVPADKAQWGAQEIARLMAEQMGPVLVGTDPEVGGRSWGSL YGADF" } , annot { { data ftable { { data prot { name { "DNA polymerase" } } , location int { from 0 , to 603 , id local str "Penny1_45" } } } } } } , seq { id { local str "Penny1_46" } , descr { title "Hypothetical Protein SEA_PENNY1_50 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 62 , seq-data ncbieaa "MDTHIINALGRILVSPPEQPVQMAVAFMATWDSLVDAGEDQTASAADLFKKFA ATFTELQSL" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 61 , id local str "Penny1_46" } } } } } } , seq { id { local str "Penny1_47" } , descr { title "HTH DNA binding domain protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 82 , seq-data ncbieaa "MSNSLLEHLSVINDLVEDVVRENTELKRKLAAQNDNRKKLSPGEVNTMRLMKR AGFTQAEIAESFDVNPATVSRIVRGIYHR" } , annot { { data ftable { { data prot { name { "HTH DNA binding domain protein" } } , location int { from 0 , to 81 , id local str "Penny1_47" } } } } } } , seq { id { local str "Penny1_48" } , descr { title "Hypothetical Protein SEA_PENNY1_52 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 62 , seq-data ncbieaa "MKEITIVLRDGPMVHVHGELALDASERSLLVYGDSGAHMNFNWDNVLYYAVAP SVEESTNGV" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 61 , id local str "Penny1_48" } } } } } } , seq { id { local str "Penny1_49" } , descr { title "ThyX Thymidylate synthase [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 235 , seq-data ncbieaa "MKVKLIASTVLEDPYWAGTGYEDSGTPSSADELAEFAGRNCYRSFSRPNPATR ENVDYLKHILDVGHESVLEHASATFYIEASRSVLTELERHRHLSFSVVSQRYVDPTELGVHEPPAVKDLIDAPGRGYF RAKELLEEIQHASAEAYDELVTIYAEAGLGRKKAREAARAVLPNMTNSPMVVTGNHRAWRYVIKARWHEAADAEIRSL AGELLKQLREIAPHTYQDIPDTPYTY" } , annot { { data ftable { { data prot { name { "ThyX Thymidylate synthase" } } , location int { from 0 , to 234 , id local str "Penny1_49" } } } } } } , seq { id { local str "Penny1_50" } , descr { title "Hypothetical Protein SEA_PENNY1_54 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 196 , seq-data ncbieaa "MTMIDPFASAPADDEAQAVPAEAPEPEESLFDEPPAEAPKKAPAKKAAAKVTN VVAPSEGKVVLTFKGGTGFDAPWIVIHAESLQDAYEQMVGENGALLGELFTRVQNAGQAFAKLAPQPAGGGNGGNRGG GNQRQSSAPQAAQEAPNGEKRYCAHGEMKFKSGVSKKNGKPYQMFVCNSGDRNDECDAQFLNSRR" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 195 , id local str "Penny1_50" } } } } } } , seq { id { local str "Penny1_51" } , descr { title "Ribonucleotide reductase [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 672 , seq-data ncbieaa "MTNWGPTGELVYNRTYSRTKPDGSKETWPETVRRVVDGNLALVDERYHLDGER EDLIRLMEDFKILPGGRHLWASGVKNAQHLFNCWVSGWGPKPSDHFEFTFMRLMEGGGVGANYSNRFLADYAEVQQEL YVHIVCDPDHPDYEAMKEAGVLSTEYDPDWAGAFIVEDSREGWAAALVDLIDTHYRDEVSHFQRVYDVSRVRQFGAKL KTFGGTASGPLPLARMLIDVCEILSEIAHDGERLDGISAMGIDHAIAQCVVAGGVRRSARMAMMHWNDPQIDRFVGIK ADTGSHWTTNISVEVDQDFWDAVKIGGGNAEYILRKITEGMVANGEPGFWDSSLSNVGEPNEVVCTNPCGEITLEPWE PCNLGHVNLAAFVREDTNKVDYLGLYKAHRLITRFLIRATFSEVADPKSREVLDRNRRIGVGHLGVASFLAMTGKRYS EAPASPFRDVLRHLAHEVDKAAEEFAHQLRIPVPVKKRTVAPTGTIAKMPGVSEGIHPIFSRYFIRRVRLSMSDPEQT RMLADYGRQGYEVEDDLYAKFTGVVSIPTQDTLVAEVVKRYGRDAEDLVESADQLTLNEMLAFQAMYQMIWADNAVSF TANVDPDKYNADDVRQQLRTFGGLLKGATIFPEASMPQAPYERITKQQYEQATAKAVADGVDEDCANGACPIR" } , annot { { data ftable { { data prot { name { "Ribonucleotide reductase" } } , location int { from 0 , to 671 , id local str "Penny1_51" } } } } } } , seq { id { local str "Penny1_52" } , descr { title "Hypothetical Protein SEA_PENNY1_56 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 68 , seq-data ncbieaa "MNGDSIFDAKFNGMGGSEMYRAQIVPDLFPHEKPMLIDNWPEEDRLLFCGGEA AKEFYRNEIEKRGAA" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 67 , id local str "Penny1_52" } } } } } } , seq { id { local str "Penny1_53" } , descr { title "Hypothetical Protein SEA_PENNY1_57 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 37 , seq-data ncbieaa "MKRDPYIDPRTGLNNVDAILEDQRAGLLTYEEPEDER" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 36 , id local str "Penny1_53" } } } } } } , seq { id { local str "Penny1_54" } , descr { title "HTH DNA binding domain protein [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 240 , seq-data ncbieaa "MTENKIERLSKPIKRAAKIVASQWPGVIEADDLEQTLYLKLLESPGTVDKVLG LEPKAKDRFLVRMGHQIASQERTDYAYYKGSYRYSLAEVKKLLKAGALKGLELDPEVQTYDSDGGKPQGGESKPPIDS AILDLRNALEALRSRNEAYADAVVKRHLFDEFPESESESQVLKRAVPALTDEMNRVRRVEHVTRDDGPGTRQSVRRES ARYVSKSQWDNDAPVLPAQYRDNAVEKEVWE" } , annot { { data ftable { { data prot { name { "HTH DNA binding domain protein" } } , location int { from 0 , to 239 , id local str "Penny1_54" } } } } } } , seq { id { local str "Penny1_55" } , descr { title "Metallophosphoesterase [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 255 , seq-data ncbieaa "MSKRIVVISDTQIPFHDRRAVKSLIGFIGDYQPDQLLHIGDLMDYPTPARWSK GTAEEFAKRMREHNEKGKQFLDQVRAVYEGPFGIHEGNHDLRPREYLTRYAPALAEYEGFFNFENLLDFEGFGIDLLP EFNKIAPGWVTTHGHRGGIRLNQNAGSTALGAAKKFMTSVVMGHTHRLGISSHTFGYGGDVTKTVTGMEVGNLMDMRQ AHYLKGGTGNWQQGFGLLTLDGLHVKAETVPIHRGRFTVDGRVWEV" } , annot { { data ftable { { data prot { name { "Metallophosphoesterase" } } , location int { from 0 , to 254 , id local str "Penny1_55" } } } } } } , seq { id { local str "Penny1_56" } , descr { title "Hypothetical Protein SEA_PENNY1_60 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 97 , seq-data ncbieaa "MSESILEEAQRLIHGPRNKNYGHPRENFADIAALFSGYLGQPINDIDVANLMI LMKIARVKGTGYHRDSFTDIAGYAGCVERIYEEPVEAPDGLEDL" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 96 , id local str "Penny1_56" } } } } } } , seq { id { local str "Penny1_57" } , descr { title "Hypothetical Protein SEA_PENNY1_61 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 54 , seq-data ncbieaa "MNEDNVLRVGLNFPNGDLVEVAVTGWTDPLNALSALRHLGTEEALSKIYEAGT E" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 53 , id local str "Penny1_57" } } } } } } , seq { id { local str "Penny1_58" } , descr { title "Hypothetical Protein SEA_PENNY1_62 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 30 , seq-data ncbieaa "MNDPEQLALFDVDELGWTEGVHDYVHQGDE" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 29 , id local str "Penny1_58" } } } } } } , seq { id { local str "Penny1_59" } , descr { title "DNA primase [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 219 , seq-data ncbieaa "MQRLSESQRSFLRAATERYRRSLPDSPAEEYLATRGLGFPSIKDDLDKFMLGY VDDPLPGHEMFRGFLAIPYLRWSQEHGWAVVSIRYRCIEDHDHRGHGKYMTQAGDRPRLYNTLALLRQSPIIAITEGE IDAITAQVCGIPTVGVPGAQAWQPHFREPFLGYREVFILADGDEPGLQFANTVAKSLPNSKVIPMPPGEDVNSLVIKQ TKRALLERIS" } , annot { { data ftable { { data prot { name { "DNA primase" } } , location int { from 0 , to 218 , id local str "Penny1_59" } } } } } } , seq { id { local str "Penny1_60" } , descr { title "Endonucleaxe VII [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 158 , seq-data ncbieaa "MSTTKRKPSHRNQDRAHKRKPCVDCVAEGITTKRKAPHPGPRCATHHRAKRAQ RRDTSWETRIFATYGITAEEYWAIYEFQGGRCYGCRRANGKRKRLSVDHDHETGIVRGLLCTACNRNVLGHLRDEREA FQRFIDYLDNPPAVQVLGERITPDMAA" } , annot { { data ftable { { data prot { name { "Endonucleaxe VII" } } , location int { from 0 , to 157 , id local str "Penny1_60" } } } } } } , seq { id { local str "Penny1_61" } , descr { title "Hydrolase [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 274 , seq-data ncbieaa "MKLKHKTIVLDDGFRVGVSQVGTGVPLVFLHGLTVSALAYEELLIELAQRGFA VTALDAVNHGRTDSLPFGHTVEEMTRVTLRALDALGIDKAVFVGHSMGGGMVTEIAPRYPERVLAAVLLDAAAGKEHH ANLKDPLRATQRLSGAVVDVFGDTYQAIKLRSATEGLGLAQTLRSSFAGFRFVRAAYALLKADTEPLLKAMKALDVQT AVIHGLSDQIVPFAAGKSAAASSGGALYAVEGFHSWMLADPELAAEVIVFALLGFYPQRYLLGAG" } , annot { { data ftable { { data prot { name { "Hydrolase" } } , location int { from 0 , to 273 , id local str "Penny1_61" } } } } } } , seq { id { local str "Penny1_62" } , descr { title "Hypothetical Protein SEA_PENNY1_67 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 139 , seq-data ncbieaa "MRRVLITGSRDWVARTTIWNALNAELHQFQHEGIVVVHGGARGADDIADRWAW GARQSGWPVQIEKHEAEWDEHGKRAGVIRNQKMVDLGADVCHAFPLQGSVGTRHCMARAIAAGIPVVNHGFQPYTNQA QQFAEAYG" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 138 , id local str "Penny1_62" } } } } } } , seq { id { local str "Penny1_63" } , descr { title "Hypothetical Protein SEA_PENNY1_68 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 76 , seq-data ncbieaa "MAKPTPKANRLHQQILGDLIATKPTVWTQKSIDPNSPDPKRPIVIERKHYGTE LARPLARNVSEHNVERAAKRWIP" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 75 , id local str "Penny1_63" } } } } } } , seq { id { local str "Penny1_64" } , descr { title "DnaB dsDNA helicase [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 269 , seq-data ncbieaa "MYTPLQSLYIKGSAGDPLPTVWDALEVKGTRFLRGQLALVCAGPGTGKSAFVL TYALLARVPTLYFSADSDAFTQLSRSLSILTGWSMEKSARAVREGDLGDAEDEFRDIPIRFNYNASPSLDQIEASMMS YEEVYGDFPALVVIDNVTNVRTGSDEDDPFAGLESLMDYLHDMARSTSACVVGLHHVTGGYNDADKAIPLSGVKGQIS RVPEMILTLHRVSEQFGSDSLRVSTVKNRGGRSDPSGLDYAELEFIGDTMQIRDFSTSTT" } , annot { { data ftable { { data prot { name { "DnaB dsDNA helicase" } } , location int { from 0 , to 268 , id local str "Penny1_64" } } } } } } , seq { id { local str "Penny1_65" } , descr { title "Hypothetical Protein SEA_PENNY1_70 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 24 , seq-data ncbieaa "MSIPEAIVIGLSLGIFIGLVTAGR" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 23 , id local str "Penny1_65" } } } } } } , seq { id { local str "Penny1_66" } , descr { title "Hypothetical Protein SEA_PENNY1_71 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 20 , seq-data ncbieaa "MIYLLAIFLHIYGRPVEWDE" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 19 , id local str "Penny1_66" } } } } } } , seq { id { local str "Penny1_67" } , descr { title "Hypothetical Protein SEA_PENNY1_72 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 102 , seq-data ncbieaa "MIPRWLLLLKYLTENGVIMKKKPNLDDPEVRSWLYRTEEGPHESAAVLRMHRA GYPGPVIMKTLQLKGTQLMQALNKAITDEQDAASRGRAIHDALIARGTK" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 101 , id local str "Penny1_67" } } } } } } , seq { id { local str "Penny1_68" } , descr { title "Hypothetical Protein SEA_PENNY1_73 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 64 , seq-data ncbieaa "MRNIQPGMNIAKQRRKLTQLAAEAPPSHVGYIEHLIRLFDAEVAAGRPTPASQ FIPMYHEEFGL" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 63 , id local str "Penny1_68" } } } } } } , seq { id { local str "Penny1_69" } , descr { title "Hypothetical Protein SEA_PENNY1_74 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 70 , seq-data ncbieaa "MSTETEYWNVHMGPKPGLPAWHVLTQPSRTPFPTLEAATRFAKTHKQIDPSRD IVIEYPDGRKWNGKEWV" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 69 , id local str "Penny1_69" } } } } } } , seq { id { local str "Penny1_70" } , descr { title "Hypothetical Protein SEA_PENNY1_75 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 75 , seq-data ncbieaa "MTVKVNDRKLEPGTEVSIKGERGRFRFVKSTTTSQGKTVLDFIGGPAGHEQWR SFYPERVETVHRIARTRANAKK" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 74 , id local str "Penny1_70" } } } } } } , seq { id { local str "Penny1_71" } , descr { title "Hypothetical Protein SEA_PENNY1_76 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 46 , seq-data ncbieaa "MAEVAKKAGTTAWTGAWRLPTDQKDHRKAVRAQRRRDKQELRKEAP" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 45 , id local str "Penny1_71" } } } } } } , seq { id { local str "Penny1_72" } , descr { title "RecB exonuclease/helicase [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 271 , seq-data ncbieaa "MTDTRKHRSVSQLKQYERCPYSYKLARVDKVWQRPAAWLPQGSAVHTVLEEYR RRELDGDPMSLEEAQEMFKEEYAKEVSQYTDVTPNFDWWFRSGRYDGASDLERRWHIGLEQIEKFFAWTEGHPEEVIW IAPDGTPGIELGFDIDLDGVLVRGYIDAVLRDSNGNVIVRDYKTGNTPGDDFQLGVYSVALAETYGIEPPQIGDYYMA GKKGVKGKPTYPYDLGEWPRERVAEKFRELEENIAAERFDPDPEPDKCAFCDVSYHCPFAMG" } , annot { { data ftable { { data prot { name { "RecB exonuclease/helicase" } } , location int { from 0 , to 270 , id local str "Penny1_72" } } } } } } , seq { id { local str "Penny1_73" } , descr { title "Hypothetical Protein SEA_PENNY1_78 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 144 , seq-data ncbieaa "MPLQVLSRPLGLPDPVVRVAEPGLLFAETCNLLDVTGLLVYRSPMVQDSDPVY ENVADLLQRSRVGLIARDLVDDPMMYFGQGEWSIYLLHSTHDPVVVSDPRVIEVLEVINSFKVTGPILPTEAGLEFHH RLRRLHDIKELTG" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 143 , id local str "Penny1_73" } } } } } } , seq { id { local str "Penny1_74" } , descr { title "Immunity Repressor [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 169 , seq-data ncbieaa "MTKEDIDRLSLAVVEDLKNKGFNQSEIAEMYGVTRQYVSWIKHTYGGRLTPRE EVLKEFPFDVPRNMGQTSPFKRLRDHGEYVATGGVGMPDEKLKRLRSFYRKLRDEGLVLEFDPDIPPIDGVSAQGGWR YVEATPEERESGILIRENEHSRITQKGRMIWRFPPREP" } , annot { { data ftable { { data prot { name { "Immunity Repressor" } } , location int { from 0 , to 168 , id local str "Penny1_74" } } } } } } , seq { id { local str "Penny1_75" } , descr { title "Hypothetical Protein SEA_PENNY1_80 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 87 , seq-data ncbieaa "MKGLIAAMLATLGLLLTPAPAQAGPTCEHRSAAHIAEHGGINADSAWHVAHGQ LPTCDYSSNGGEARNSDGDNDNEKSRFCRKRWYC" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 86 , id local str "Penny1_75" } } } } } } , seq { id { local str "Penny1_76" } , descr { title "Hypothetical Protein SEA_PENNY1_81 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 59 , seq-data ncbieaa "MDRYAVVIVSKHIGFSHTWQEIFHGEEGAEQAHALAETWNAKHPWAAFVVGLH PETVPA" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 58 , id local str "Penny1_76" } } } } } } , seq { id { local str "Penny1_77" } , descr { title "Hypothetical Protein SEA_PENNY1_82 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 77 , seq-data ncbieaa "MEIGNVDQVKSALESFRSMLQLKQDFIEENQDPDDGEPECGYSRWDEAITDYN YELAYYGEQLADAVAEALGIKEED" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 76 , id local str "Penny1_77" } } } } } } , seq { id { local str "Penny1_78" } , descr { title "Hypothetical Protein SEA_PENNY1_83 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 76 , seq-data ncbieaa "MDEVKNFVEVWGDGYLAGDLAEKLTCIEVEALASLLLSLGANEAATKWIEYHA EADDCGDQHCRCDDEECKAEREG" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 75 , id local str "Penny1_78" } } } } } } , seq { id { local str "Penny1_79" } , descr { title "Hypothetical Protein SEA_PENNY1_84 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 255 , seq-data ncbieaa "MDGKTAKMQKQVAKLLRHAEDVVGTPEEAVFMAKAFELIAKYGLDMASIQADK QGLDTSDMPDAIKWSARIDGKYTAQQVLLLHGLVVALHCKAVMTHEVSSGTRYPVLHIFGVPRHIERVQFLWEILRPQ MLRLVENVRPAEGFTPRYTYDYRTGEYRQKKTSGQLKSYRRAWIAGFAQTVSERVKAQEDKVLESAESGALVLYRGDK ERAALALREAFPRTRRARGRTRFDSNGYAHGQRDGRNAAFARALAS" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 254 , id local str "Penny1_79" } } } } } } , seq { id { local str "Penny1_80" } , descr { title "Hypothetical Protein SEA_PENNY1_85 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 81 , seq-data ncbieaa "MAVIEAKHYEETRQRLAKDPLVLALAEEIRGLPREQMVHEDSDTPRFEFMQAA NREYRRRGGTDGGHIGAIAEAIIRILDA" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 80 , id local str "Penny1_80" } } } } } } , seq { id { local str "Penny1_81" } , descr { title "Hypothetical Protein SEA_PENNY1_86 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 127 , seq-data ncbieaa "MKVFVYKNLHATKKVGHTVYSIKALSGSRKGKVIARSRNVMIGLAEGKVSEAG RQRVLRERKKSVHAGIVGHLMGTHPVDPETLGGTTSRITYNPYKYEQFVHADTEAPFEGAPVVCLSDEGVIAVN" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 126 , id local str "Penny1_81" } } } } } } , seq { id { local str "Penny1_82" } , descr { title "Hypothetical Protein SEA_PENNY1_87 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 71 , seq-data ncbieaa "MNIRQLAALIPPDKAQLAVAEVIAALGARQSWDADTLDDVANAVKSVVPEQVP SPFDQDEAAVEFWEGMWW" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 70 , id local str "Penny1_82" } } } } } } , seq { id { local str "Penny1_83" } , descr { title "Hypothetical Protein SEA_PENNY1_88 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 52 , seq-data ncbieaa "MSFQEWMRRVDRVMLAVTGLTHRDIADWNYRDAYDDDVSPRTAALKALANSL" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 51 , id local str "Penny1_83" } } } } } } , seq { id { local str "Penny1_84" } , descr { title "Hypothetical Protein SEA_PENNY1_89 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 102 , seq-data ncbieaa "MDTNRLKLAFARLLVAGTAMGAMLLGDQIEGTDSTRIKGDDNGDGIVMEDESG WDCRAMSNLICGPANDQGVAAGRYEAGVLVETWDQMLARCGGSDLCLGA" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 101 , id local str "Penny1_84" } } } } } } , seq { id { local str "Penny1_85" } , descr { title "Hypothetical Protein SEA_PENNY1_90 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 239 , seq-data ncbieaa "MASLKRSNDRKVANHVKVSKSGKASPGIQNTFGLPSGRQFSCTEATDFCSKIC YAGNLEKIYKGVSDVLLHNWELLKDASREDMIIMLGEMVAAFVKDCDKRKAPKLFRIHWDGDFFSPTYVTAWAKVIAD NPDVQFWAYTRVQTAAVFLHAQKLSNLALYFSADRDNIEVARFLEGKGINIAYVDQTFAEGKAQFPNATRCPENNKAI ELISDKGSACARCGLCINGRKSVLFSVSKR" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 238 , id local str "Penny1_85" } } } } } } , seq { id { local str "Penny1_86" } , descr { title "Hypothetical Protein SEA_PENNY1_91 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 38 , seq-data ncbieaa "MIYGDHKVISVNARGDVLRVLVEDMETGEREYRVIPMA" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 37 , id local str "Penny1_86" } } } } } } , seq { id { local str "Penny1_87" } , descr { title "Hypothetical Protein SEA_PENNY1_92 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 40 , seq-data ncbieaa "MSYEVRDGLGQVHTFDTPAEAEAFARERRTFTWANVFPVR" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 39 , id local str "Penny1_87" } } } } } } , seq { id { local str "Penny1_88" } , descr { title "Hypothetical Protein SEA_PENNY1_93 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 52 , seq-data ncbieaa "MAKGQTFQNGQGLHSHGFNWAETLTVVRKDPMSYGVERYLVRDRYGRHGYAY" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 51 , id local str "Penny1_88" } } } } } } , seq { id { local str "Penny1_89" } , descr { title "DNA primase [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 135 , seq-data ncbieaa "MADEPLIVKVIHRYHPEWEPPRQGRNDWMKTRCPFHGDETPSASISFKHNAFR CFACPVKGSAVAIIKEQEEVSYAEAKRIAEELSPGGDGTIPAQPSRQSRRRVFGDKGSGVSQHQGRPGQVHARVRGRS TPWS" } , annot { { data ftable { { data prot { name { "DNA primase" } } , location int { from 0 , to 134 , id local str "Penny1_89" } } } } } } , seq { id { local str "Penny1_90" } , descr { title "Hypothetical Protein SEA_PENNY1_42 [Mycobacteriophage Penny1]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 41 , seq-data ncbieaa "MLSRYRYKGRHWTGSVFLYGGRPDRSGAIWVRWDGKGLVPL" } , annot { { data ftable { { data prot { name { "Hypothetical Protein" } } , location int { from 0 , to 40 , id local str "Penny1_90" } } } } } } } , annot { { data ftable { { data cdregion { frame one , code { id 11 } } , comment "HNH endonuclease" , product whole local str "Penny1_1" , location int { from 525 , to 818 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Minor tail protein" , product whole local str "Penny1_2" , location int { from 855 , to 1274 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "minor tail protein" , product whole local str "Penny1_3" , location int { from 1360 , to 1680 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "minor tail protein" , product whole local str "Penny1_4" , location int { from 1680 , to 2624 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_5" , location int { from 2628 , to 3263 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_6" , location int { from 3290 , to 3799 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_7" , location int { from 4166 , to 4420 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Lysin A" , product whole local str "Penny1_8" , location int { from 4417 , to 5961 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Lysin B" , product whole local str "Penny1_9" , location int { from 5961 , to 6926 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Terminase" , product whole local str "Penny1_10" , location int { from 6956 , to 8656 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Portal protein" , product whole local str "Penny1_11" , location int { from 8653 , to 10107 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Capsid maturation protease" , product whole local str "Penny1_12" , location int { from 10104 , to 10943 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Scaffolding protein" , product whole local str "Penny1_13" , location int { from 10981 , to 11505 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Major capsid protein" , product whole local str "Penny1_14" , location int { from 11538 , to 12530 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "head-to-tail connector protein" , product whole local str "Penny1_15" , location int { from 12601 , to 12786 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "head-to-tail connector protein" , product whole local str "Penny1_16" , location int { from 12795 , to 13166 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "head-to-tail connector protein" , product whole local str "Penny1_17" , location int { from 13163 , to 13297 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "head-to-tail connector protein" , product whole local str "Penny1_18" , location int { from 13294 , to 13662 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "head-to-tail connector protein" , product whole local str "Penny1_19" , location int { from 13664 , to 14023 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "head-to-tail connector protein" , product whole local str "Penny1_20" , location int { from 14034 , to 14441 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Major tail protein" , product whole local str "Penny1_21" , location int { from 14472 , to 15068 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Tail assembly chaperone" , product whole local str "Penny1_22" , location int { from 15119 , to 15580 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Tail assembly chaperone" , product whole local str "Penny1_23" , location mix { int { from 15119 , to 15556 , strand plus , id local str "Penny1" } , int { from 15556 , to 15978 , strand plus , id local str "Penny1" } } } , { data cdregion { frame one , code { id 11 } } , comment "tape measure protein" , product whole local str "Penny1_24" , location int { from 15978 , to 19004 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "minor tail protein" , product whole local str "Penny1_25" , location int { from 19011 , to 20381 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Minor tail protein" , product whole local str "Penny1_26" , location int { from 20378 , to 22174 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Minor tail protein" , product whole local str "Penny1_27" , location int { from 22197 , to 22640 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Minor tail protein" , product whole local str "Penny1_28" , location int { from 22651 , to 22965 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Minor tail protein" , product whole local str "Penny1_29" , location int { from 22962 , to 23264 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Minor tail protein" , product whole local str "Penny1_30" , location int { from 23276 , to 25033 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_31" , location int { from 25033 , to 25320 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_32" , location int { from 25381 , to 25647 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Integrase, (Y-int)" , product whole local str "Penny1_33" , location int { from 25644 , to 26789 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_34" , location int { from 27199 , to 27630 , strand plus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "HTH DNA binding domain protein" , product whole local str "Penny1_35" , location int { from 27721 , to 27903 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_36" , location int { from 27919 , to 28047 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_37" , location int { from 28048 , to 28191 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "deoxycytidilate deaminase" , product whole local str "Penny1_38" , location int { from 28192 , to 28575 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_39" , location int { from 28698 , to 28868 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_40" , location int { from 28865 , to 29104 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_41" , location int { from 29097 , to 29462 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_42" , location int { from 29449 , to 29634 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_43" , location int { from 29634 , to 29828 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_44" , location int { from 29828 , to 30010 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "DNA polymerase" , product whole local str "Penny1_45" , location int { from 30041 , to 31855 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_46" , location int { from 31866 , to 32054 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "HTH DNA binding domain protein" , product whole local str "Penny1_47" , location int { from 32063 , to 32311 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_48" , location int { from 32304 , to 32492 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "ThyX Thymidylate synthase" , product whole local str "Penny1_49" , location int { from 32502 , to 33209 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_50" , location int { from 33269 , to 33859 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Ribonucleotide reductase" , product whole local str "Penny1_51" , location int { from 33891 , to 35909 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_52" , location int { from 35906 , to 36112 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_53" , location int { from 36102 , to 36215 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "HTH DNA binding domain protein" , product whole local str "Penny1_54" , location int { from 36212 , to 36934 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Metallophosphoesterase" , product whole local str "Penny1_55" , location int { from 36938 , to 37705 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_56" , location int { from 37702 , to 37995 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_57" , location int { from 37992 , to 38156 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_58" , location int { from 38153 , to 38245 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "DNA primase" , product whole local str "Penny1_59" , location int { from 38242 , to 38901 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Endonucleaxe VII" , product whole local str "Penny1_60" , location int { from 39148 , to 39624 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Hydrolase" , product whole local str "Penny1_61" , location int { from 39706 , to 40530 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_62" , location int { from 40527 , to 40946 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_63" , location int { from 40943 , to 41173 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "DnaB dsDNA helicase" , product whole local str "Penny1_64" , location int { from 41197 , to 42006 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_65" , location int { from 42006 , to 42080 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_66" , location int { from 42077 , to 42139 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_67" , location int { from 42136 , to 42444 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_68" , location int { from 42441 , to 42635 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_69" , location int { from 42632 , to 42844 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_70" , location int { from 42844 , to 43071 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_71" , location int { from 43068 , to 43208 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "RecB exonuclease/helicase" , product whole local str "Penny1_72" , location int { from 43237 , to 44052 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_73" , location int { from 44049 , to 44483 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "Immunity Repressor" , product whole local str "Penny1_74" , location int { from 44499 , to 45008 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_75" , location int { from 45367 , to 45630 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_76" , location int { from 45627 , to 45806 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_77" , location int { from 45809 , to 46042 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_78" , location int { from 46044 , to 46274 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_79" , location int { from 46276 , to 47043 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_80" , location int { from 47140 , to 47385 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_81" , location int { from 47403 , to 47786 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_82" , location int { from 47783 , to 47998 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_83" , location int { from 48011 , to 48169 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_84" , location int { from 48171 , to 48479 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_85" , location int { from 48510 , to 49229 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_86" , location int { from 49256 , to 49372 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_87" , location int { from 49385 , to 49507 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_88" , location int { from 49520 , to 49678 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , comment "DNA primase" , product whole local str "Penny1_89" , location int { from 38717 , to 39124 , strand minus , id local str "Penny1" } } , { data cdregion { frame one , code { id 11 } } , product whole local str "Penny1_90" , location int { from 28572 , to 28697 , strand minus , id local str "Penny1" } } } } } } } }