Gordonia phage Emperor
Add or modify phage thumbnail images to appear at the top of this page.
Know something about this phage that we don't? Modify its data.
Detailed Information for Phage Emperor | |
Discovery Information | |
Isolation Host | Gordonia terrae 3612 |
Found By | Matthew Montgomery |
Year Found | 2016 |
Location Found | Pittsburgh, PA USA |
Finding Institution | University of Pittsburgh |
Program | Phage Hunters Integrating Research and Education |
From enriched soil sample? | No |
Isolation Temperature | 30°C |
GPS Coordinates | 40.444579 N, 79.955428 W Map |
Discovery Notes | Emperor was found as a prophage of Gordonia westfalica NRRL-B-24152. Liquid Gordonia westfalica was spotted on Gordonia terrae 3612, and the resulting phage release was picked and amplified, and called Emperor. |
Naming Notes | I named this after Emperor Palpatine, because I like Star Wars and the name has a decent ring to it. |
Sequencing Information | |
Sequencing Complete? | Yes |
Date Sequencing Completed | Sep 13, 2016 |
Sequencing Facility | Pittsburgh Bacteriophage Institute |
Shotgun Sequencing Method | Illumina |
Sequencer Used | Illumina MiSeq |
Read Type | Single-end reads |
Read Length | 150 bp |
Approximate Shotgun Coverage | 8002 |
Genome length (bp) | 16604 |
Character of genome ends | 3' Sticky Overhang |
Overhang Length | 10 bases |
Overhang Sequence | CCTGCGCCCT |
GC Content | 70.1% |
Sequencing Notes | The last feature of this genome is not in phamerator or in the gene list: CDS join(16287..16604,1..96) /gene="25" /locus_tag="PBI_EMPEROR_25" /codon_start=1 /transl_table=11 /product="HNH endonuclease" /translation="MTALPAWAGDYSRRLTALCLATYGDTCHLCGRPGATTADHLIPR SVSYDDSLANLRPAHQRCNSARGAMPIETWRARFTASTAPRSSRWSRPSSSLTPQVSA ALRPAAFFSPNAQNKGSVHTEKPSETTKGPDNATT" |
Fasta file available? | Yes: Download fasta file |
Characterization | |
Cluster | DM |
Subcluster | -- |
Cluster Life Cycle | Temperate |
Lysogeny Notes | Emperor is able to integrate into Gordonia westfalica. |
Other Cluster Members |
Click to View |
Annotating Institution | University of Pittsburgh |
Annotation Status | In GenBank |
Plaque Notes | Plaques vary in size, from very small to large (about 2mm). Plaques are not perfectly circular, have "fuzzy" edges. |
Number of Genes | 24 |
Number of tRNAs | 0 |
Number of tmRNAs | 0 |
Has been Phamerated? | Yes |
Gene List |
Click to ViewEmperor_1 Emperor_2 Emperor_3 Emperor_4 Emperor_5 Emperor_6 Emperor_7 Emperor_8 Emperor_9 Emperor_10 Emperor_11 Emperor_12 Emperor_13 Emperor_14 Emperor_15 Emperor_16 Emperor_17 Emperor_18 Emperor_19 Emperor_20 Emperor_21 Emperor_22 Emperor_23 Emperor_24 |
Submitted Minimal DNA Master File | Download |
Publication Info | |
Uploaded to GenBank? | Yes |
GenBank Accession | MH271296 |
Refseq Number | None yet |
Archiving Info | |
Archiving status | Archived |
Pitt Freezer Box# | 5 |
Pitt Freezer Box Grid# | B2 |
Available Files | |
Final DNAMaster File | Download |
GenBank File for Phamerator | Download |