Gordonia phage Emperor
Know something about this phage that we don't? Modify its data.
Detailed Information for Phage Emperor
Discovery Information
Isolation HostGordonia terrae 3612
Found ByMatthew Montgomery
Year Found2016
Location FoundPittsburgh, PA USA
Finding InstitutionUniversity of Pittsburgh
ProgramPhage Hunters Integrating Research and Education
From enriched soil sample?No
Isolation Temperature30°C
GPS Coordinates40.444579 N, 79.955428 W Map
Discovery NotesEmperor was found as a prophage of Gordonia westfalica NRRL-B-24152. Liquid Gordonia westfalica was spotted on Gordonia terrae 3612, and the resulting phage release was picked and amplified, and called Emperor.
Naming NotesI named this after Emperor Palpatine, because I like Star Wars and the name has a decent ring to it.
Sequencing Information
Sequencing Complete?Yes
Date Sequencing CompletedSep 13, 2016
Sequencing FacilityPittsburgh Bacteriophage Institute
Shotgun Sequencing MethodIllumina
Sequencer UsedIllumina MiSeq
Read TypeSingle-end reads
Read Length150 bp
Approximate Shotgun Coverage8002
Genome length (bp)16604
Character of genome ends3' Sticky Overhang
Overhang Length10 bases
Overhang SequenceCCTGCGCCCT
GC Content70.1%
Sequencing Notes The last feature of this genome is not in phamerator or in the gene list:
CDS join(16287..16604,1..96)
/gene="25"
/locus_tag="PBI_EMPEROR_25"
/codon_start=1
/transl_table=11
/product="HNH endonuclease"
/translation="MTALPAWAGDYSRRLTALCLATYGDTCHLCGRPGATTADHLIPR
SVSYDDSLANLRPAHQRCNSARGAMPIETWRARFTASTAPRSSRWSRPSSSLTPQVSA
ALRPAAFFSPNAQNKGSVHTEKPSETTKGPDNATT"
Fasta file available?Yes: Download fasta file
Characterization
ClusterDM
Subcluster--
Cluster Life CycleTemperate
Lysogeny NotesEmperor is able to integrate into Gordonia westfalica.
Other Cluster Members

Click to View

Annotating InstitutionUniversity of Pittsburgh
Annotation StatusIn GenBank
Plaque NotesPlaques vary in size, from very small to large (about 2mm). Plaques are not perfectly circular, have "fuzzy" edges.
Number of Genes24
Number of tRNAs0
Number of tmRNAs0
Has been Phamerated?Yes
Gene List
Submitted Minimal DNA Master FileDownload
Publication Info
Uploaded to GenBank?Yes
GenBank AccessionMH271296
Refseq NumberNone yet
Archiving Info
Archiving status Archived
Pitt Freezer Box# 5
Pitt Freezer Box Grid# B2
Available Files
Final DNAMaster FileDownload
GenBank File for PhameratorDownload