Gordonia phage Emperor
Add or modify phage thumbnail images to appear at the top of this page.
Know something about this phage that we don't? Modify its data.
| Detailed Information for Phage Emperor | |
| Discovery Information | |
| Isolation Host | Gordonia terrae 3612 |
| Found By | Matthew Montgomery |
| Year Found | 2016 |
| Location Found | Pittsburgh, PA USA |
| Finding Institution | University of Pittsburgh |
| Program | Phage Hunters Integrating Research and Education |
| From enriched soil sample? | No |
| Isolation Temperature | 30°C |
| GPS Coordinates | 40.444579 N, 79.955428 W Map |
| Discovery Notes | Emperor was found as a prophage of Gordonia westfalica NRRL-B-24152. Liquid Gordonia westfalica was spotted on Gordonia terrae 3612, and the resulting phage release was picked and amplified, and called Emperor. |
| Naming Notes | I named this after Emperor Palpatine, because I like Star Wars and the name has a decent ring to it. |
| Sequencing Information | |
| Sequencing Complete? | Yes |
| Date Sequencing Completed | Sep 13, 2016 |
| Sequencing Facility | Pittsburgh Bacteriophage Institute |
| Shotgun Sequencing Method | Illumina Sequencing |
| Approximate Shotgun Coverage | 8002 |
| Genome length (bp) | 16604 |
| Character of genome ends | 3' Sticky Overhang |
| Overhang Length | 10 bases |
| Overhang Sequence | CCTGCGCCCT |
| GC Content | 70.1% |
| Sequencing Notes | The last feature of this genome is not in phamerator or in the gene list: CDS join(16287..16604,1..96) /gene="25" /locus_tag="PBI_EMPEROR_25" /codon_start=1 /transl_table=11 /product="HNH endonuclease" /translation="MTALPAWAGDYSRRLTALCLATYGDTCHLCGRPGATTADHLIPR SVSYDDSLANLRPAHQRCNSARGAMPIETWRARFTASTAPRSSRWSRPSSSLTPQVSA ALRPAAFFSPNAQNKGSVHTEKPSETTKGPDNATT" |
| Fasta file available? | Yes: Download fasta file |
| Characterization | |
| Cluster | DM |
| Subcluster | -- |
| Cluster Life Cycle | Temperate |
| Lysogeny Notes | Emperor is able to integrate into Gordonia westfalica. |
| Other Cluster Members |
Click to View |
| Annotating Institution | University of Pittsburgh |
| Annotation Status | In GenBank |
| Plaque Notes | Plaques vary in size, from very small to large (about 2mm). Plaques are not perfectly circular, have "fuzzy" edges. |
| Has been Phamerated? | Yes |
| Gene List |
Click to ViewEmperor_1 Emperor_2 Emperor_3 Emperor_4 Emperor_5 Emperor_6 Emperor_7 Emperor_8 Emperor_9 Emperor_10 Emperor_11 Emperor_12 Emperor_13 Emperor_14 Emperor_15 Emperor_16 Emperor_17 Emperor_18 Emperor_19 Emperor_20 Emperor_21 Emperor_22 Emperor_23 Emperor_24 |
| Submitted Minimal DNA Master File | Download |
| Publication Info | |
| Uploaded to GenBank? | Yes |
| GenBank Accession | MH271296 |
| Refseq Number | None yet |
| Archiving Info | |
| Archiving status | Archived |
| Pitt Freezer Box# | 5 |
| Pitt Freezer Box Grid# | B2 |
| Available Files | |
| Final DNAMaster File | Download |
| GenBank File for Phamerator | Download |